KEGG   Geobacillus thermocatenulatus: GT3921_00775Help
Entry
GT3921_00775      CDS       T05178                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
gtm  Geobacillus thermocatenulatus
Pathway
gtm03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gtm00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    GT3921_00775
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gtm03011]
    GT3921_00775
Ribosome [BR:gtm03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    GT3921_00775
  Bacteria
    GT3921_00775
  Archaea
    GT3921_00775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ASS97736
UniProt: A0A1V9BXS9
Position
complement(142209..142550)
Genome map
AA seq 113 aa AA seqDB search
MQAKAVARTVRIAPRKARLVIDLIRGKEVGEAFAILRHTPKAASPIIEKVLKSAVANAEH
NYDMDVNNLVITQAYVDEGPTLKRFRPRAMGRASAINKRTSHITIVVSEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaaagctgttgccagaaccgttcgcatcgctcctcgtaaagcgcgcttagtc
attgacctgattcgcgggaaggaagtgggcgaagcgttcgcgattttgcgccatacacca
aaagcagcttccccgatcattgagaaagtgttgaaatcagcagttgccaacgctgaacac
aactatgacatggacgtcaacaacttggtcattactcaagcgtatgtcgacgagggcccg
acgctgaaacggttccgtccgcgtgccatgggacgggcaagcgccattaacaaacgcaca
agccatattacgatcgtcgtttcagaaaagaaggagggataa

DBGET integrated database retrieval system