KEGG   Geobacillus thermocatenulatus: GT3921_01245Help
Entry
GT3921_01245      CDS       T05178                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
gtm  Geobacillus thermocatenulatus
Pathway
gtm00450  Selenocompound metabolism
gtm00970  Aminoacyl-tRNA biosynthesis
gtm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    GT3921_01245
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GT3921_01245
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gtm01007]
    GT3921_01245
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gtm03016]
    GT3921_01245
Enzymes [BR:gtm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     GT3921_01245
Amino acid related enzymes [BR:gtm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   GT3921_01245
Transfer RNA biogenesis [BR:gtm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    GT3921_01245
 Prokaryotic type
   Other AARSs
    GT3921_01245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1d DNA_ligase_ZBD Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: ASS97806
UniProt: A0A226Q4H0
Position
complement(227266..229218)
Genome map
AA seq 650 aa AA seqDB search
MEKKTFYLTTPIYYPSDRLHIGHAYTTVAGDAMARYKRMRGYDVMYLTGTDEHGQKIQRK
AEEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQERHKKVVEQIFTRLVEQGDIYL
GEYEGWYCTPCESFYTERQLVDGNCPDCGRPVEKVKEESYFFRMSKYVDRLLQYYEENPD
FIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVIYVWIDALANYITALGY
GTDNDEKFRKYWPADVHLVGKEIVRFHTIYWPIMLMALGLPLPKKVFGHGWLLMKDGKMS
KSKGNVVDPVTLIDRYGLDALRYYLLREVPFGADGVFTPEGFIERINYDLANDLGNLLHR
TVAMIEKYFDGVIPPYRGPKTPFDQELAQTAREVVRQYEEAMEGMEFSVALAAVWQLISR
TNKYIDETQPWVLAKDEQKRDELAAVMTHLAESLRHTAVLLQPFLTRTPERMFAQLGITD
HSLKEWDSLYDFGLIPEGTKVQKGEPLFPRLDIEAEVEYIKAHMQGGKPAAEPVKEEKKA
TEAAEISIDEFAKVDLRVAEVIHAERMKNADKLLKLQLDLGGEKRQVISGIAEFYKPEEL
VGKKVICVANLKPAKLRGEWSEGMILAGGSGGEFSLATVDQHVPNGTKIK
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaaaacgttttatttgacgacgccgatttattacccgagcgaccgcctgcat
atcggtcatgcttacacaacggtggcgggggacgccatggctcgctataaacggatgcgc
ggctacgatgtcatgtatttgaccggcaccgatgagcatgggcaaaaaattcagcgcaag
gcggaagaaaaaggagtcacgccgcagcaatacgtcgatgagatcgtcgctggcattcag
gagctatggaagaagctcgacatttcctacgacgattttattcgcacaacgcaggagcgg
cataaaaaagtcgtcgaacaaattttcacccgtcttgtcgaacaaggcgatatttatttg
ggcgaatatgaaggctggtattgtacgccgtgcgaatcgttttacacagagcggcagctt
gtggacggcaactgtccggactgcggccggcctgttgagaaagtgaaagaagagtcctat
ttcttccggatgagcaaatatgtcgaccgcttgttgcaatattacgaagaaaatcccgat
tttatccaaccggaatcgcggaaaaatgagatgatcaacaacttcattaagccggggctt
gaggatttggctgtgtcccggacgacgttcgattggggcattaaagtgccaggcaatccg
aagcatgtcatctatgtctggatcgacgcgcttgccaactatatcacagcgctcggctac
ggcacggacaacgatgaaaagttccgcaaatattggccggcggacgtccatttggtcggc
aaagaaatcgtccgtttccatacgatttattggccgattatgttgatggcgctcggcttg
ccgttgccgaaaaaagtattcggccatggctggttgctgatgaaggatggaaaaatgtcc
aaatcgaaaggaaatgtcgtcgacccagtgacgctcatcgaccggtatgggcttgatgcg
ctccgctattatttgctgcgggaagtgccgttcggcgctgatggcgtgtttacgccggaa
ggatttattgagcgcatcaactatgacttggccaacgacttaggcaacttgttgcaccgt
accgtggcgatgatcgagaaatatttcgacggcgttattccgccataccgcgggccgaaa
acaccgtttgaccaagagttggcgcaaacggcgcgcgaagtggtgcgtcaatatgaagag
gcgatggagggaatggagttttccgtcgcgctcgccgctgtttggcagttgattagccgg
acgaacaaatacatcgatgaaacgcagccatgggtattggcgaaagacgaacagaaacgg
gatgagcttgctgccgtcatgacccacttggctgaatcgcttcgccataccgcggttctg
ctccagccgtttttgacgcgcacgccggagcgcatgttcgctcagctcggcatcacggat
cattcattaaaagaatgggacagcttgtacgatttcggcctcattccggaagggacaaaa
gtgcaaaagggagaaccgctcttcccgcgcctcgacatcgaagcggaagtggagtacatt
aaggcgcatatgcaagggggcaaaccggccgccgaaccggtaaaagaggaaaaaaaagca
acggaggcggcggaaatttcgattgatgagttcgccaaagtcgatttgcgcgtcgctgaa
gtcatccatgccgaacgtatgaaaaacgccgataagctgttgaagcttcagcttgacctt
ggcggcgagaagcggcaagtgatctccggcattgctgagttttacaaaccagaagaactc
gtcggcaaaaaagtcatttgcgtcgccaatttaaaaccagccaagcttcgcggcgaatgg
tcggaaggcatgattctagccggaggcagcggcggggagttttcgctggcgacggttgat
caacacgtgccgaatggaacgaaaatcaaataa

DBGET integrated database retrieval system