KEGG   Geobacillus thermocatenulatus: GT3921_06035Help
Entry
GT3921_06035      CDS       T05178                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K08679  UDP-glucuronate 4-epimerase [EC:5.1.3.6]
Organism
gtm  Geobacillus thermocatenulatus
Pathway
gtm00520  Amino sugar and nucleotide sugar metabolism
gtm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GT3921_06035
Enzymes [BR:gtm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.6  UDP-glucuronate 4-epimerase
     GT3921_06035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 3Beta_HSD NAD_binding_4 adh_short NAD_binding_10 KR UDPG_MGDP_dh_N Glyco_tran_WecB 2-Hacid_dh_C Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: ASS98633
UniProt: A0A226QCI9
Position
1219120..1220064
Genome map
AA seq 314 aa AA seqDB search
MKIVVTGGAGFIGSHLAARLSGLGYDVAAVDCFHPYYPAERKARQFQALTGGRVPLARFD
LLDREQTMRWFAQCRPDVVYHLAALPGVPYSLEEPLAYIDYDIKATVNVLAAAGEAGAAH
VLFASSSSVYGDRGNVPLREEMADGRVVSPYAAAKYGAESFCHAYAHLYGYQMTIFRYFT
VYGPWGRPDMAIGTFLHRLLAGEEIVVYGKGTARDYTYIDDIVEGMIAALHRSGGRSEVF
NLGAGAPVTMEQLLAELRKHFPDMKIVHAPERKGDVKATWADITKAERAFGYRPNVPFAE
GLARTVAWAREYER
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatcgttgtcactggaggagccggatttattggcagccatctagccgcccggtta
agcggactcggatatgacgtggctgcagtggattgttttcatccctattatcctgccgaa
cggaaagcgcggcagtttcaggcgctcacgggcgggcgggtgccgcttgcccgcttcgat
ttgctcgaccgggaacaaacgatgcgctggtttgcccaatgccgcccggatgtcgtctac
catttggcggcgctgccgggcgtgccgtattccctcgaggagccgctcgcgtatatcgat
tatgacatcaaagcgacggtcaatgtgttggcggcggcgggggaagcgggggcggcgcat
gtgctgtttgcctcatcgtcatcggtgtacggcgaccgcggcaatgtgccgctccgggaa
gagatggctgacggccgcgtcgtgtcgccgtatgcggcggcgaaatacggagcggaatcg
ttttgtcatgcctatgcccatttgtatggctaccaaatgacgattttccgctatttcacc
gtttacgggccgtggggtcgtccggatatggcgatcggcacgtttttgcaccgattgctg
gcgggcgaggagattgtcgtgtatggcaaggggacggcgcgcgattatacgtacatcgat
gatattgtggagggcatgatcgcagcacttcaccgcagcggcgggcgaagcgaagtgttc
aacttgggcgccggggcgcccgtcaccatggagcagttgctcgctgagttgcggaagcac
tttcccgatatgaaaatcgtgcacgcgccggagcgaaaaggggacgtgaaggcaacatgg
gcggacatcacaaaggcggaaagggcgtttggttaccggccgaacgtgccgtttgccgaa
gggctcgcccgtacggtggcgtgggcgcgtgaatatgagcggtag

DBGET integrated database retrieval system