KEGG   Geobacillus thermocatenulatus: GT3921_08225Help
Entry
GT3921_08225      CDS       T05178                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
gtm  Geobacillus thermocatenulatus
Pathway
gtm00860  Porphyrin and chlorophyll metabolism
gtm01100  Metabolic pathways
Module
gtm_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:gtm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GT3921_08225
Enzymes [BR:gtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     GT3921_08225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF3530
Motif
Other DBs
NCBI-ProteinID: ASS99031
UniProt: A0A226QE59
Position
1661567..1662217
Genome map
AA seq 216 aa AA seqDB search
MGRHLALTLIRPGMTEQNRRRAYIGWTDAPLAAEERCRLHRLQMERPCAVDCLVTSDLHR
CRETAALLFGGRGADWCTSRWRELHFGAWEGKTFAELEAEPAYRQWLASPFSAAPPGGER
YADFQARIKQALAETIAFAERAGARHVAVITHGGPIRLLLEQYAPDARSFWEWEVPFAGG
YMLESTIERWKGGERCISLSAVRFKENENGCGNGME
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggggcgtcatttggctcttacactcatccgccctgggatgacggaacaaaaccgacgt
cgggcgtatattggctggacggatgcaccgcttgcagctgaggagcgttgcaggttgcac
cgcttgcagatggagcggccatgtgcggtcgattgccttgtgacaagcgaccttcaccgt
tgtcgagaaacggccgccttgctgtttggcggacgcggggccgattggtgcaccagccgc
tggcgcgagcttcactttggcgcttgggaaggaaaaacgtttgctgagctggaagcggag
cccgcctaccggcaatggcttgcgtcgcccttttccgcggcgccgcccggcggggagcgt
tatgccgattttcaagcgcgcatcaaacaggcgcttgcggagacgattgcgttcgctgag
cgggcgggcgcccgtcatgtggctgtcatcacccatggcggcccgattcgcctcctgctc
gagcagtatgcgcccgatgcccgttcgttttgggaatgggaggtgccatttgccggcgga
tatatgttggaatcgacgatcgagcgttggaaagggggagagcggtgcatttcgttatcg
gcggtgcgtttcaaggaaaacgaaaatgggtgcgggaacggtatggaataa

DBGET integrated database retrieval system