KEGG   Geobacillus thermocatenulatus: GT3921_18015Help
Entry
GT3921_18015      CDS       T05178                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
gtm  Geobacillus thermocatenulatus
Pathway
gtm00970  Aminoacyl-tRNA biosynthesis
gtm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GT3921_18015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gtm03029]
    GT3921_18015
Enzymes [BR:gtm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     GT3921_18015
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     GT3921_18015
Mitochondrial biogenesis [BR:gtm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GT3921_18015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AST00727
UniProt: A0A1V9BP59
Position
complement(3674348..3675778)
Genome map
AA seq 476 aa AA seqDB search
MNFETVIGLEVHVELKTKSKIFSSSPNAFGAPPNTQTNVIDLGYPGVLPVLNRQAVEFAM
KAAMALNCEIATETKFDRKNYFYPDNPKAYQISQYDQPLGRNGWIEIEVNGKKKKIGITR
IHLEEDAGKLTHTGDGYSLVDFNRQGTPLIEIVSEPDIRSPEEAYAYLEKLKAIIQYTGV
SDCKMEEGSLRCDANISLRPLGSDKFGTKTELKNLNSFNFVRMGLEYEAKRQEKILLSGG
VIRQETRRFDEATKTTVLMRVKEGSEDYRYFPEPDLVMLYIDDEWKERVRASIPELPDAR
RKRYIEEWGLPEYDAKVLTLTKEMADFFEATVANGADPKLASNWLMVEVSGYLNAEQKEL
HDIALTPESLAGMIKLIQNGTISSKIAKKVFKELVEHGGDPEKIVKEKGLVQISDEGALR
KIVLEVLDANPQSVEDYKNGKDRALGFLVGQVMKATKGQANPPLVNKLLVEEIGKR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaaacggtcatcggacttgaggtgcacgtcgagctgaaaacgaaatcgaaa
attttctccagcagcccgaacgcgttcggcgcgcccccgaacacgcaaacgaacgtcatt
gacttagggtatccaggcgtgctgccggtgttgaaccgacaggcggtcgagtttgcgatg
aaagcggcgatggcgttaaactgcgaaatcgcgaccgagacgaaattcgaccgcaaaaac
tacttttatccggacaacccgaaagcgtaccaaatttcgcaatacgatcagccgcttggc
cgaaatggctggattgaaattgaagtaaacggaaaaaagaaaaaaatcggcatcacccgc
atccatctcgaagaagacgccggcaagctgacgcatacgggcgacggctattcgctcgtg
gattttaaccgtcaagggacgccgctcattgagatcgtctccgagccagacatccgctcg
ccggaagaagcgtacgcctacttggaaaaattaaaagcgatcatccaatataccggcgtt
tccgactgcaaaatggaagaagggtcgcttcgctgcgacgccaatatttcgcttcgcccg
ctcggttcggacaagttcggcacaaaaacggaattgaaaaacctcaactcgttcaacttc
gtccgcatggggttggaatacgaagcgaagcggcaggagaaaattttgctttcaggcggc
gtcatccgccaagaaacgcggcgctttgacgaagcgacgaaaacgaccgtcctcatgcgc
gtcaaagaaggatcggaagactaccgctacttcccggagccggacttggtcatgctctat
attgacgacgaatggaaagagcgtgtccgcgcctcgattccggagctgcctgacgcccgc
cggaagcggtatatcgaggagtggggcttgccggaatacgacgccaaagtgctgacgctg
accaaagaaatggcggatttcttcgaagcaacggtcgcaaacggcgccgatccgaaactg
gcgtcgaactggctcatggtcgaagtatccgggtacttaaacgccgagcaaaaagagctc
catgacatcgcgttgacgccggaaagtttggctgggatgatcaaactcatccaaaacggc
acgatttcgtcgaaaatcgcgaaaaaagtgttcaaagaactcgtcgaacacggcggcgac
ccagagaaaatcgtcaaagaaaaagggctcgtgcaaatttccgacgaaggagcgttgcgc
aaaattgtgctcgaagtgctcgacgccaacccgcagtcggtcgaagactataaaaacggc
aaagaccgcgcgctcggcttccttgtcggccaagtgatgaaagcgacgaaaggacaagcg
aatccgccgcttgtcaataagctgttagtagaggaaattggaaaacgataa

DBGET integrated database retrieval system