KEGG   Geobacillus thermodenitrificans: GTNG_0030Help
Entry
GTNG_0030         CDS       T00496                                 

Definition
(GenBank) Methionine-tRNA ligase/methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00450  Selenocompound metabolism
gtn00970  Aminoacyl-tRNA biosynthesis
gtn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    GTNG_0030
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GTNG_0030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gtn01007]
    GTNG_0030
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gtn03016]
    GTNG_0030
Enzymes [BR:gtn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     GTNG_0030
Amino acid related enzymes [BR:gtn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   GTNG_0030
Transfer RNA biogenesis [BR:gtn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    GTNG_0030
 Prokaryotic type
   Other AARSs
    GTNG_0030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f Use1 Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: ABO65417
UniProt: A4IJB3
Position
42085..44037
Genome map
AA seq 650 aa AA seqDB search
MEKKTFYLTTPIYYPSDKLHIGHAYTTVAGDTLARYKRMRGYDVMYLTGTDEHGQKIQRK
AEEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQERHKKVVEKIFARLVEQGDIYL
GEYEGWYCTPCESFYTERQLVDGNCPDCGRPVEKVKEQSYFFRMSKYVDRLLQYYEENPD
FIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALANYITALGY
GTDNDEKFRKYWPADVHLVGKEIIRFHTIYWPIMLMALDLPLPKKVFGHGWLLMKDGKMS
KSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPEGFIERINYDLANDLGNLLNR
TVAMIKKYFDGVIPPYRGPKTPFDEELVQTAREVVRQYEEAMERMEFSVALASVWQLIGR
TNKYIDETQPWVLAKDESKREELASVMTHLAESLRHTAVLLQPFLTRTPERIFAQLGIAD
RSLKEWDSLYEFGLIPEGTNVQKGEPLFPRLDIEAEVEYIKAHMQGGKPAVEPVKEEKQA
AETAEISIDEFAKVDLRVAEVVHAERMKNANKLLNLQLDLGGEKRQVISGIAEFYKPEEL
IGKKVICVANLKPAKLRGEWSEGMILAGGNGGEFSLATVDQHVPNGTKIK
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaagacgttttatttgacgacgccgatttattatccgagcgacaaattgcac
atcggccatgcttatacaacagtggcgggggatacgctagcgcgctataaacggatgcgc
ggttacgatgttatgtatttgacgggaaccgatgagcacgggcaaaaaattcaacgcaag
gcggaggaaaaaggagtaacgccgcagcaatatgtcgatgagatcgtcgctggcattcag
gagctatggaaaaagctcgacatttcttatgacgatttcatccgtacaacgcaggagcgg
cataaaaaagtagtcgaaaagattttcgcgcgtcttgtcgaacaaggggatatttattta
ggtgaatatgaaggatggtattgcacgccatgcgaatcgttttacactgagcggcagctt
gtcgacggcaactgcccggactgtggtcgtccggttgaaaaagtgaaagagcagtcgtac
tttttccgaatgagcaaatacgtcgaccgtttgcttcaatattatgaggaaaatccagat
ttcatccagccggaatcgcggaaaaacgaaatgattaacaattttattaagccggggctt
gaagatttagctgtgtcgcggacgacgtttgactggggcattaaagtgccgggcgatccg
aaacatgtcatttacgtctggattgacgcgcttgccaactatattacagcgctcggttac
ggcacggacaatgatgaaaagttccgcaaatattggccggccgatgtccatttagtcggc
aaggaaatcatccgctttcatacgatttattggccgattatgctcatggcgcttgacttg
ccgctgccgaaaaaagtattcggtcatggctggctgctcatgaaagacgggaaaatgtcg
aaatcgaaaggcaatgtcgttgacccggtgacgttgatcgatcgatacggactcgatgcg
cttcgttattatttactcagggaagtgccgttcggttctgacggcgtattcacgccggaa
ggatttattgagcgcatcaactacgatttagccaatgacctaggcaatttattgaatcgt
acagtagcgatgattaagaaatattttgatggggtgattccgccgtaccgcggtccgaaa
acgccgtttgacgaagagctggtacaaacggcgcgtgaggtggtccgtcagtatgaggaa
gcgatggaacggatggagttttccgttgcccttgcttcggtttggcaactgattggccgg
acgaacaaatacattgatgagacgcagccatgggtattggccaaagatgaaagcaaacgg
gaagagcttgcttctgtcatgacccacctagccgagtcgctccgccatacggcagtgctg
ttgcagccgtttttgacacgcacgccagagcgcatttttgcccagctcggcattgccgac
cgttcattaaaagagtgggatagcttgtacgagttcgggctcattccggaaggaacaaac
gtgcaaaaaggagaaccactgttcccgcgccttgatattgaagcggaagtcgagtacatt
aaggcgcatatgcaaggcggcaagccggcggtggaacccgttaaagaggagaagcaagcg
gctgagacggccgaaatctcaattgatgagtttgccaaagttgacttgcgcgttgctgaa
gtcgtgcatgctgaacggatgaaaaacgccaataagctgttgaacctccaacttgatctt
ggcggcgagaaacggcaagtcatctctggtatcgctgaattttacaaaccagaggaactc
atcggcaaaaaggtcatttgcgtcgccaatttaaaaccggccaaactgcgcggtgagtgg
tcggaaggaatgattttggccggcggtaacggcggagagttttcactggcgaccgtcgat
caacatgtgccaaacggaacaaaaattaaataa

DBGET integrated database retrieval system