KEGG   Geobacillus thermodenitrificans: GTNG_0924Help
Entry
GTNG_0924         CDS       T00496                                 

Definition
(GenBank) Dihydrolipoyl acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00010  Glycolysis / Gluconeogenesis
gtn00020  Citrate cycle (TCA cycle)
gtn00620  Pyruvate metabolism
gtn01100  Metabolic pathways
gtn01110  Biosynthesis of secondary metabolites
gtn01120  Microbial metabolism in diverse environments
gtn01130  Biosynthesis of antibiotics
gtn01200  Carbon metabolism
Module
gtn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTNG_0924
   00020 Citrate cycle (TCA cycle)
    GTNG_0924
   00620 Pyruvate metabolism
    GTNG_0924
Enzymes [BR:gtn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GTNG_0924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ABO66302
UniProt: A4ILU8
Position
996729..998039
Genome map
AA seq 436 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEIL
VPEGTVATVGQTLITLDAPGYENMTFKGQEHEEEAKKEEKTETVSKEESVGATAPAAAAE
AAAEADPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRILKEDIDAFLAGGAKAAAQPA
PAAEAEEKAAPQAAATPVVPEGEFPETREKMSGIRRAIAKAMVNSKHTAPHVTLMDEVDV
TKLVAHRKKFKAIAAEKGIKLTFLPYVVKALVSALREYPTLNTSIDDQTEEIIHKHYYNI
GIAADTDRGLLVPVIKHADRKPIFALAQEINELAVKARDGKLAPNEMKGASCTITNIGSA
GGQWFTPVINHPEVAILGIGRIAEKPIVRDGEIVAAPVLALSLSFDHRMIDGATAQKALN
HVKRLLSDPELLLMEA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaagctgccggacattggcgaaggcattcatgaaggcgagatcgtg
aaatggtttgtgaaaccaggcgatgaagtgaacgaagatgatgtgttgtgtgaagtacaa
aacgacaaggcagtcgtagaaatcccgtcgccggtcaaaggaaaagtgcttgagattctt
gtcccggaaggaaccgttgcgacggtcgggcaaacgcttatcacgctcgacgcaccggga
tatgaaaacatgacgtttaaaggacaagagcacgaagaagaggcgaaaaaagaggaaaaa
acggaaacggtgtcgaaagaagaaagcgttggggccaccgccccggcagccgcagcagag
gctgcagcagaagccgatccaaatcgtcgcgtcatcgcgatgccgtctgtgcgcaaatat
gcgcgtgaaaaaggtgtggacattcgtctcgtccaaggaacggggaaaaatggccgcatc
ttgaaagaagatatcgatgctttccttgctggcggtgcgaaagctgcagcccaaccggcg
ccggcagcagaagctgaagaaaaagcagcgccgcaggcagcggcgacaccggttgtgcca
gaaggcgaattcccggaaacgcgcgagaaaatgagcggcattcgccgagcgatcgccaaa
gcgatggtgaattcgaaacatacagctccgcacgtgacgctcatggacgaagtcgacgtg
acgaaactagttgcccaccggaaaaagttcaaagcgatcgcagcagaaaaaggtatcaag
ctgacgttcttgccgtatgtcgtcaaagcgctcgtttcggcgttgcgtgaatatccgacg
ctgaatacgtcaatcgatgatcaaacagaagaaatcatccataagcactattacaacatc
ggcatcgctgctgacacagatcgtggtttgctcgtgccggtcattaagcatgccgaccgg
aagccgattttcgcgttggcgcaagaaattaacgagctcgccgtaaaagctcgcgacggc
aagctagcgccaaatgaaatgaaaggtgcatcgtgcacgattacaaacatcggttcggct
ggtgggcaatggttcactccggtcatcaatcatccggaagtagcgattcttggcatcggt
cgcatcgcggaaaaaccgattgtccgcgacggcgaaatcgtcgccgctccagtcttagcg
ctctcgttgagcttcgatcatcgaatgatcgatggagcaacggcacaaaaagcactcaac
catgtgaaacggctgttaagtgacccagaactattattaatggaggcgtaa

DBGET integrated database retrieval system