KEGG   Geobacillus thermodenitrificans: GTNG_1507Help
Entry
GTNG_1507         CDS       T00496                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00071  Fatty acid degradation
gtn00072  Synthesis and degradation of ketone bodies
gtn00280  Valine, leucine and isoleucine degradation
gtn00310  Lysine degradation
gtn00362  Benzoate degradation
gtn00380  Tryptophan metabolism
gtn00620  Pyruvate metabolism
gtn00630  Glyoxylate and dicarboxylate metabolism
gtn00640  Propanoate metabolism
gtn00650  Butanoate metabolism
gtn00900  Terpenoid backbone biosynthesis
gtn01100  Metabolic pathways
gtn01110  Biosynthesis of secondary metabolites
gtn01120  Microbial metabolism in diverse environments
gtn01130  Biosynthesis of antibiotics
gtn01200  Carbon metabolism
gtn01212  Fatty acid metabolism
gtn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gtn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GTNG_1507
   00630 Glyoxylate and dicarboxylate metabolism
    GTNG_1507
   00640 Propanoate metabolism
    GTNG_1507
   00650 Butanoate metabolism
    GTNG_1507
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GTNG_1507
   00072 Synthesis and degradation of ketone bodies
    GTNG_1507
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GTNG_1507
   00310 Lysine degradation
    GTNG_1507
   00380 Tryptophan metabolism
    GTNG_1507
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GTNG_1507
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GTNG_1507
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GTNG_1507
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gtn04147]
    GTNG_1507
Enzymes [BR:gtn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GTNG_1507
Exosome [BR:gtn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GTNG_1507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABO66877
UniProt: A4INH3
Position
1590864..1592033
Genome map
AA seq 389 aa AA seqDB search
MKRDAVIVSAVRTAIARQGGALATLPAHVYGAEVIKEAMRRANIGPELVADVIMGNVLSG
GGNIARLTALQTGLSLELTGLTVDRQCGSGINAVNLAAQAIWAGDGDVYIAGGVESMSRA
PYLMDRPEKPYSSTPPSFRKSQLSPKEIGDPPMGITAENLVKKYGISREEQDAFALRSQQ
RMARAMQEGRFDEQIVPITVPVKKGEPFVFDTDEHPRPNTTMEALAKLPPAFLEGGTVTA
GNSSGLNDAAAALVVMSREKAEQLGLTPLAVVRAYAVAGVDPNIMGIGPVPATRKVLEKV
GLTLDEMDIIEINEAFAAQVIACDRELEMNPEKVNVNGGAIAHGHPLGATGAILITKAVY
ELKRRGGTYALITACIGGGQGIATIIERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgagatgccgtcattgtgtcggctgtaagaacggccatcgcccgccaagggggc
gccttggcgacgctgccagcgcacgtttacggtgcggaagtcatcaaagaagcgatgcgg
cgggcgaacatcggcccggaacttgtcgctgatgtcatcatgggcaatgtcttaagcggc
ggtggcaacattgcccggctgacggcgttgcagacggggctgtcgcttgagctgaccggg
ctgaccgtcgaccgccaatgcggttcaggcattaatgccgtcaatttagcggcgcaagcc
atttgggcaggcgacggggacgtctatatcgctggaggggtggaaagcatgagccgcgcg
ccgtatttgatggaccgcccggaaaagccgtacagttcgacgccgccaagcttccgtaaa
tcgcagttgtcgccgaaagagattggcgacccgccgatgggcatcacggcagaaaattta
gtgaaaaaatacggcatcagtcgtgaagaacaagatgcctttgccctgcgcagccagcag
cgcatggcgcgtgctatgcaagaagggcggtttgacgaacaaattgtgccgattaccgtt
ccggtgaaaaaaggggagccgtttgtcttcgatacggatgaacacccgcgtccgaacacg
acgatggaagcactcgcgaaactgccgccggcgtttttggaaggcggaacagtgacggca
gggaatagttcgggactcaatgacgccgctgctgcactcgtcgtcatgtcgcgggaaaaa
gcggaacagctcggcttaacaccgcttgccgtcgtccgcgcctatgcggtcgccggagtc
gacccgaacattatgggcatcggtccggtaccagcgacaagaaaggtgcttgaaaaggtt
ggactgacgcttgatgagatggatatcatcgaaattaatgaagcgtttgccgctcaggtg
atcgcctgtgaccgcgagcttgagatgaatccggaaaaagtaaatgtcaacggcggcgcc
atcgcccacggccatccgcttggtgcgacgggtgcaattttgattacgaaagccgtgtat
gaactaaagcgtcgcggtgggacatacgccctcattacggcgtgcatcggcggcggccaa
gggatcgcgacgatcattgaacgagcctga

DBGET integrated database retrieval system