KEGG   Geobacillus thermodenitrificans: GTNG_1670Help
Entry
GTNG_1670         CDS       T00496                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00670  One carbon pool by folate
gtn00790  Folate biosynthesis
gtn01100  Metabolic pathways
Module
gtn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GTNG_1670
   00670 One carbon pool by folate
    GTNG_1670
Enzymes [BR:gtn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     GTNG_1670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ABO67034
UniProt: A4INY0
Position
complement(1761668..1762237)
Genome map
AA seq 189 aa AA seqDB search
MNMTILKSSVMTLIRRLKRQWRCKGEKTMISHIVAMDENRVIGKDNQLPWHLPADLAYFK
RVTMGHAIVMGRKTFEAIGRPLPGRDNVVVTRNPQFRPEGCLVLHSLEEVKQWIAARGEE
VFIIGGAELFKATMPIADRLYVTNIFASFPGDTFYPPISEKEWKVVSYTPGVKDEKNPYE
HAFLIYERK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgacgattttgaaatcgtcggttatgaccctcatccgacgattaaagcgccag
tggcggtgtaaaggagagaagacgatgatttcgcacattgtggcgatggatgaaaaccgg
gtgatcggcaaagataatcagttgccgtggcatttgccggccgatttagcgtatttcaag
cgggtaacgatggggcatgccatcgtgatggggcgcaaaacgtttgaagcgatcggtcgg
ccgctccccggccgagacaacgtcgtcgtgacacgcaatccccaatttcgcccggaaggc
tgccttgtgctccattcgcttgaggaagtcaagcaatggatcgcagcgcgtggtgaagaa
gtgtttattatcggtggagctgaattgtttaaagcaacaatgccgatcgccgatcgacta
tacgtgacgaacattttcgcctcattccctggcgatacgttttatccgcctatttccgaa
aaagagtggaaagtcgtttcctatacgccaggagtaaaagacgaaaaaaatccgtatgag
cacgcgtttctcatttacgagcggaaatga

DBGET integrated database retrieval system