KEGG   Geobacillus thermodenitrificans: GTNG_1718Help
Entry
GTNG_1718         CDS       T00496                                 

Gene name
porG
Definition
(GenBank) Gamma subunit of pyruvate oxidoreductase
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00010  Glycolysis / Gluconeogenesis
gtn00020  Citrate cycle (TCA cycle)
gtn00620  Pyruvate metabolism
gtn00640  Propanoate metabolism
gtn00650  Butanoate metabolism
gtn00680  Methane metabolism
gtn01100  Metabolic pathways
gtn01120  Microbial metabolism in diverse environments
gtn01130  Biosynthesis of antibiotics
gtn01200  Carbon metabolism
Module
gtn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTNG_1718 (porG)
   00020 Citrate cycle (TCA cycle)
    GTNG_1718 (porG)
   00620 Pyruvate metabolism
    GTNG_1718 (porG)
   00640 Propanoate metabolism
    GTNG_1718 (porG)
   00650 Butanoate metabolism
    GTNG_1718 (porG)
  Energy metabolism
   00680 Methane metabolism
    GTNG_1718 (porG)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    GTNG_1718 (porG)
Enzymes [BR:gtn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     GTNG_1718 (porG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4_7 Fer4_10 Fer4 Fer4_6 Fer4_21 Fer4_2 Fer4_9 Fer4_16 Fer4_8 Fer4_4 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ABO67082
UniProt: A4IP28
Position
complement(1815970..1816980)
Genome map
AA seq 336 aa AA seqDB search
MLPKTNEQGFFEIRLESIGGLGANLAGKMFAEAGVLWSGLNGANFSSYGSEKKGTPVKSF
IRFCEPHIEIRDHSPIATPHVIGVFHEALAKMVDVTSGLVADGTAVVNSTREFDDIRRDL
RLPYGTLVIVDALGIAVEERVKINMPMVGALLRVCSFIQPEAMETVIRRTFATKAPHLVE
ANIRAFRRGYEEVRIQASPAPTEERTFVRPSPRFGYETQLIGGVIVAGGNSLLKNVSGSR
QGFLPRWEADKCIHCVACDNVCPDLCFVWEERVDKKGRKQMFLAGIDYQYCKGCLKCVEA
CPTAALVAEREVPGFAEAHSLKHSFSFMKGGMEAWQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgctgccaaagacgaatgagcaaggtttttttgagattcgcctcgagtcgatcggcggg
ttgggggcgaacttggcggggaaaatgttcgctgaggctggcgtgttgtggtcggggctg
aatggggcgaacttttcttcgtacggttccgagaaaaaaggaacaccggtcaaaagcttt
atccgcttttgcgagccgcatattgaaattcgtgatcatagtccgatcgccactccacac
gtcattggtgtgtttcatgaggcactcgccaaaatggtcgatgtgacgagcggtcttgtc
gctgacggaacggccgtcgtgaattcaacgcgcgagttcgatgacattcgccgcgattta
cgcctgccttacgggacgttggtgatagtcgatgcgctcggcatcgctgtcgaggagcga
gtgaaaatcaacatgccgatggtaggggcgctgttgcgcgtttgttcttttatccaaccg
gaagcgatggagacggtcattcgccggacgttcgccacaaaagcgccgcatctcgtcgaa
gcaaatattcgcgcttttcgtcgcgggtatgaggaagtgcggattcaagcatctcccgct
ccgacggaggaaagaacgttcgtccgtcctagccctcgatttggatatgaaacacagctg
atcggcggtgtgattgtcgctggcggaaatagtttgttgaaaaatgtaagcggttcccgt
caagggtttttgccacgttgggaagccgacaaatgtattcattgtgtcgcctgtgacaac
gtctgtcccgatctttgcttcgtttgggaggaacgggtggacaaaaaagggcgcaaacag
atgtttttagctggcattgactatcaatattgcaaaggttgtttaaaatgtgtcgaagcg
tgtccgacggctgcgcttgtggccgaacgggaagtgccgggatttgccgaagcacattcc
ttgaaacattcgttttcgtttatgaaagggggaatggaagcatggcaatga

DBGET integrated database retrieval system