KEGG   Geobacillus thermodenitrificans: GTNG_1777Help
Entry
GTNG_1777         CDS       T00496                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00010  Glycolysis / Gluconeogenesis
gtn00052  Galactose metabolism
gtn01100  Metabolic pathways
gtn01110  Biosynthesis of secondary metabolites
gtn01120  Microbial metabolism in diverse environments
gtn01130  Biosynthesis of antibiotics
Module
gtn_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTNG_1777
   00052 Galactose metabolism
    GTNG_1777
Enzymes [BR:gtn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     GTNG_1777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABO67141
UniProt: A4IP87
Position
complement(1882092..1883141)
Genome map
AA seq 349 aa AA seqDB search
MDISKKIWTQLHEKDVLLFTLMNDRGMELSATNYGCIVTKLLVPDRNGNVENVVLGFNDF
DPYLTNTPYFGAVIGRVAGRIQGASFELDGVTYQLAKNENNNHLHGGPNGFHRVLWEAEP
IQRDNGVGVIFSYTSPDGEEGYPGTVNVQVTYWLNNDNEWIVTYRAHSDQTTLFNLTNHT
YFNLSGNLKRDILDHTLTIQSSRVLELNKELIPTGAVIDVAGTPFDLRQGKRVREAVESG
HPQIELVGQGYDHPFWLDRHHDKEIVLYDDESGRMLTVETDEVGVVVYTSNQLPEGLDLN
GAPSRKYLGICLETQGLPDAIHHAQFPSWVLSANEERVSTTMYRFGIAE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ttggatatttccaaaaaaatatggactcaacttcatgaaaaagacgttcttttgttcacg
ttgatgaatgaccgcggcatggaactatcggcgacgaattatggctgcattgtgacgaaa
ctgcttgtcccggatcggaatggaaacgtcgagaacgttgtacttggatttaacgacttt
gatccatatttgacgaataccccttactttggggcggtgatcggccgggtagcaggacgt
attcaaggggctagctttgaacttgatggcgtcacgtatcaattagcgaaaaacgaaaac
aacaaccatctgcatggcggtccgaatggattccaccgcgtactttgggaggcggagccc
atccagcgcgacaatggggtcggggtgatcttttcctatacgagtccagacggggaagaa
ggatatcctggaacagtgaatgttcaagtgacgtattggcttaataatgacaacgaatgg
atcgtcacctatcgagcccattcggaccaaacgacattgttcaacttgacaaatcatacg
tattttaacttaagcggtaacttaaaaagggatattttggaccatacgttaacgatccaa
agttcgcgcgtgttagagttgaataaggaattgattccaaccggagcagtcatcgatgtc
gccggcacaccgtttgatttgcgtcaaggaaagagagtaagagaggcagtcgaatcggga
catccgcaaattgaacttgtcgggcaaggatacgatcatccgttttggcttgaccggcat
catgacaaagaaattgtgctctatgacgacgagagtgggaggatgctgacagtcgagacg
gatgaagtcggtgtggtggtgtacacgtcaaaccaattgccggaagggctcgatcttaac
ggtgcgccatcgcgaaaatatttgggcatctgccttgaaacccaagggttgccagatgcg
attcaccatgcacagtttccgtcttgggtactgtcagcaaatgaggagcgggtatcaacg
acgatgtatcggtttggcatagctgaataa

DBGET integrated database retrieval system