KEGG   Geobacillus thermodenitrificans: GTNG_2024Help
Entry
GTNG_2024         CDS       T00496                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00220  Arginine biosynthesis
gtn00250  Alanine, aspartate and glutamate metabolism
gtn00471  D-Glutamine and D-glutamate metabolism
gtn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GTNG_2024
   00220 Arginine biosynthesis
    GTNG_2024
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    GTNG_2024
Enzymes [BR:gtn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     GTNG_2024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ABO67376
UniProt: A4IPX2
Position
complement(2143258..2144187)
Genome map
AA seq 309 aa AA seqDB search
MPVYNKEELVRFVEEAKQYARYGKVADYIPALGKANPNELSIAVYTADGKVVDAGDVTVK
VTLQSISKILALALVLIDRGEDEVFRKVGMEPTGDPFNSIAKLEEVQPSKPLNPMINAGA
LAVTHMIRGRSVEERLERLLAFIRRLAGNEQITYSEEVAQSEFETAFLNRSLCYFLKQHG
IIDEDVEELMDLYTKQCAVEMTCIDLARIGLVFALDGRDPHSGELLMPLDVARICKTFMV
TCGMYNASGEFAIKIGIPAKSGVSGGILAAVPGRCGIGIFGPALDDKGNSLTGVKLLERL
SKTYSLSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgtacaacaaagaagagcttgtccgctttgtcgaagaagcaaaacagtacgcc
cgttacggaaaagtggctgattacattcccgccttaggtaaggcgaatccgaacgagctg
tcgattgccgtgtacaccgcagacggaaaagtcgttgatgccggcgatgtgacagtcaag
gtgacgctacagagcatttccaaaattctcgcactggcccttgtgctgatcgaccgcggc
gaagacgaggtgtttcgcaaagttggtatggagccgacgggcgatccgtttaactccatt
gctaagctcgaggaagtgcagccgtccaaaccactcaacccaatgattaacgccggggcg
ttggcggtgacgcacatgattcgcggccgttctgtcgaagagcggctcgagcggcttttg
gcattcatccgccgattggcaggcaacgaacagatcacgtattcggaagaagtggctcaa
tccgagtttgaaaccgcgtttttaaaccggtcactttgctattttttgaaacagcacggc
attatcgatgaagatgttgaagagttgatggacttgtatacgaagcaatgtgccgttgag
atgacgtgcattgatttggcgcgcatcggcttagtattcgcacttgacgggcgcgacccg
cattcgggtgagctgctcatgcctcttgatgtggctcgtatttgcaaaacgttcatggtc
acgtgcggcatgtacaacgcttcaggcgagtttgccattaaaattggcattccagccaaa
agcggtgtttccggcggcattcttgctgccgtcccagggcgatgcggcatcggtattttc
ggtccggcgctcgatgataaagggaacagcttgaccggggtgaagctgctcgagcggcta
tccaaaacatattcattaagcattttttaa

DBGET integrated database retrieval system