KEGG   Geobacillus thermodenitrificans: GTNG_2148Help
Entry
GTNG_2148         CDS       T00496                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00790  Folate biosynthesis
gtn01100  Metabolic pathways
Module
gtn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GTNG_2148
Enzymes [BR:gtn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     GTNG_2148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI EccE BCDHK_Adom3 QueF HAD Adeno_GP19K
Motif
Other DBs
NCBI-ProteinID: ABO67500
UniProt: A4IQ96
Position
complement(2277787..2278377)
Genome map
AA seq 196 aa AA seqDB search
MTQEDVVCMSEINYEQIEYAVRLILEAIGEDPNREGLIDTPKRVAKMYAEVFAGLREDPK
QHFQTVFSEEHEELVLVKDIPFYSMCEHHLVPFFGVAHVAYIPREGKVTGLSKLARAVEA
VARRPQLQERITATVADSIVEALEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVF
ETDANARSEVLSLIKA
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggaggatgttgtttgtatgtcagagatcaattatgaacaaattgaatatgcg
gtccgcctcatcttggaagcgatcggcgaagatccgaaccgtgaagggcttattgataca
ccaaaacgggtggcaaaaatgtatgctgaggtgttcgccgggcttcgggaagacccgaag
cagcattttcaaaccgtattcagcgaggaacatgaggagctcgtgcttgttaaagacatt
ccgttttattcgatgtgcgaacaccatttagtgccgtttttcggcgtcgctcatgtcgct
tatattccgcgcgaaggaaaagtgaccgggttgagcaaacttgcccgggctgtcgaagcg
gtggcgcgccgtccgcagttgcaagagcgcatcacggcgacagtggccgattcaatcgtc
gaagcgctcgagccgcacggagtcatggttgtcgttgaggcggagcatatgtgtatgacg
atgcgcggcgtaaagaaaccgggggcgaaaacagtcacaacggcggtgcgtggtgtgttt
gaaacagacgccaacgcccggtccgaagtgctttcgttaattaaagcgtaa

DBGET integrated database retrieval system