KEGG   Geobacillus thermodenitrificans: GTNG_2381Help
Entry
GTNG_2381         CDS       T00496                                 

Definition
(GenBank) Glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00010  Glycolysis / Gluconeogenesis
gtn00052  Galactose metabolism
gtn00500  Starch and sucrose metabolism
gtn00520  Amino sugar and nucleotide sugar metabolism
gtn00521  Streptomycin biosynthesis
gtn01100  Metabolic pathways
gtn01110  Biosynthesis of secondary metabolites
gtn01120  Microbial metabolism in diverse environments
gtn01130  Biosynthesis of antibiotics
gtn01200  Carbon metabolism
Module
gtn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gtn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTNG_2381
   00052 Galactose metabolism
    GTNG_2381
   00500 Starch and sucrose metabolism
    GTNG_2381
   00520 Amino sugar and nucleotide sugar metabolism
    GTNG_2381
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GTNG_2381
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GTNG_2381
Enzymes [BR:gtn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GTNG_2381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA FGGY_N Hexokinase_1 Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ABO67726
UniProt: A4IQX2
Position
complement(2495143..2496096)
Genome map
AA seq 317 aa AA seqDB search
MQQWLVGIDLGGTTIKMAFVTTSGDIVHKWEIPTNISNRGEHIVADIARSLDETLVKLNA
TKEQLLAIGIGAPGPVQEETGTLYEAINLGWTNYPLKQQLEAATMLPVAVDNDVNIAAFG
EMWKGAGGGARHLLFVTLGTGVGGGVISNGTIVRGTNGAGGELGHMTMVVDGGAPCNCGK
TGCLETIASATGIVRITNEKLAADEQPSVLRGGEVTAKAVFDAAKAGDPLALQIVDEVTH
YLGLALANAANVTNPEKIVIGGGVSKAGDILVEHVTTHFRRFAFPRVAAGAEIALATLGN
DAGVIGGAWLAKALAGA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaatggttggtaggtattgatcttggcggtacaacgatcaaaatggcgtttgtg
acaactagcggcgatatcgtgcataaatgggagatcccaaccaatatttcgaatcgcggg
gagcatattgtcgctgatattgcccggtcgcttgatgagacgctcgtcaagcttaatgcg
acgaaagagcaattgctcgcaatcggcatcggcgccccggggccggtgcaagaggaaacg
gggacgctgtatgaggccatcaacttaggatggacgaattatcctttgaaacagcaattg
gaagcggcaacaatgttgccggtggctgtggataacgacgtcaatatcgctgcgttcggt
gaaatgtggaaaggagctgggggcggtgcacgccatttgctgtttgtcacgctcggcacc
ggcgtgggcggcggtgtgatctccaatggcaccatcgtgcgcgggacgaacggtgccggt
ggggagctcggccatatgacgatggtcgtcgatggaggcgcgccatgtaattgcggaaaa
accggttgtcttgaaacgattgcgtcggcgaccggaatcgtgcggatcactaacgaaaaa
ctggccgctgacgagcagccaagcgtgctgcgcggcggagaggtcaccgccaaagctgtg
tttgatgccgccaaagcaggtgatccgctcgcgctacaaatcgttgacgaagtgacgcac
tacctcggtttggcgttggcgaacgccgccaatgtaaccaatccggagaaaatcgtcatc
ggcggcggtgtctcgaaagcaggcgatatactcgttgagcatgtgaccacccatttccgt
cgtttcgcttttccacgcgtcgctgctggagctgagatcgccttggcgacgctcggcaat
gatgcgggtgtcatcggcggcgcctggctggccaaagcgcttgccggtgcctaa

DBGET integrated database retrieval system