KEGG   Geobacillus thermodenitrificans: GTNG_2473Help
Entry
GTNG_2473         CDS       T00496                                 

Definition
(GenBank) Cystathionine gamma-lyase
  KO
K17217  cystathionine gamma-lyase / homocysteine desulfhydrase [EC:4.4.1.1 4.4.1.2]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00260  Glycine, serine and threonine metabolism
gtn00270  Cysteine and methionine metabolism
gtn00920  Sulfur metabolism
gtn01100  Metabolic pathways
gtn01130  Biosynthesis of antibiotics
gtn01230  Biosynthesis of amino acids
Module
gtn_M00609  Cysteine biosynthesis, methionine => cysteine
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    GTNG_2473
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GTNG_2473
   00270 Cysteine and methionine metabolism
    GTNG_2473
Enzymes [BR:gtn01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     GTNG_2473
    4.4.1.2  homocysteine desulfhydrase
     GTNG_2473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_5 Beta_elim_lyase GDC-P
Motif
Other DBs
NCBI-ProteinID: ABO67818
UniProt: A4IR64
Position
complement(2577260..2578393)
Genome map
AA seq 377 aa AA seqDB search
MRRKTLLIHGGIPGDPHTGAVSVPIYQVSTYKQEEVGKHKGFEYSRTGNPTRAALEKLIA
DLEGGEAGFAFASGMAAITAVMMLFDSGDHIVLTDDVYGGTYRVMANVLNRFGLESTFVD
TSDIANIEAHIRPNTKAIYIETPTNPLLKITDLKAAAAIARAHGLLLIVDNTFSTPYFQT
PLELGADIVIHSATKYLGGHSDVVAGLAVVRTAELAERLHYVQNSTGGILGPQDSWLLMR
GMKTLGVRMEEHEQNARAIAAFLAEHQAVTRVYYPGLPEHPNHELAKAQMRGFGGMISFD
VGSLERAETVLSRVRYFTLAESLGAVESLISLPGKMTHASIPKERREQLGITDGLIRLSV
GLEDVNDLIDDLAQALG
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagacgaaaaacgttgctcattcatggcggcattccgggtgacccgcatacaggggcg
gtgtcggtgccgatttatcaagtgagtacgtacaagcaagaagaagttggaaagcataaa
ggatttgaatactcgcgtaccggcaacccgacgcgtgcagcgctcgaaaaactgattgct
gacctcgaaggcggcgaggccgggttcgcgttcgcttccggaatggcggcgattacggcc
gtcatgatgctgtttgacagcggggatcatattgtgctcaccgatgacgtttacggcggc
acgtatcgagtgatggcgaacgtgttaaaccgattcggattggaatcgacgttcgtcgat
acgagcgacatcgccaacatagaggcgcacattcgtccaaatacgaaagccatttacatt
gagacaccgacgaatccgttgttgaaaatcacggatttgaaggccgccgccgccattgcc
cgtgcgcacgggctgctattgatcgtcgataacacgttttcgacaccgtactttcaaacg
ccgcttgagcttggcgctgatatcgtcatccatagcgcgacgaaatatttaggcggtcat
agtgacgtcgtcgccggactggctgttgtccgcaccgccgagctcgccgagcggcttcat
tacgtgcaaaattcgacgggcggcatccttggaccgcaagattcgtggctgcttatgcgc
gggatgaaaacgcttggcgtgcggatggaagagcatgaacaaaatgcgcgggcaattgcc
gcctttttggcggagcatcaggcggttacccgcgtgtattatcctgggcttccggagcat
ccgaaccatgagctggcgaaagcacaaatgcgtgggttcggcggcatgatttcgttcgat
gtcggcagccttgagcgcgctgaaacggtgctgtcgcgtgtccgctactttacgctagct
gaaagtttaggggcagtcgaaagcttaatttcattgccagggaaaatgacacatgcgtcg
atcccgaaagagcggcgtgaacagctcggcattactgatgggctcatccgtctatcggtc
ggccttgaagacgtcaatgatttgattgacgatttggcgcaagcgcttggttga

DBGET integrated database retrieval system