KEGG   Geobacillus thermodenitrificans: GTNG_2571Help
Entry
GTNG_2571         CDS       T00496                                 

Gene name
hemL
Definition
(GenBank) Glutamate-1-semialdehyde 2,1-aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00860  Porphyrin and chlorophyll metabolism
gtn01100  Metabolic pathways
gtn01110  Biosynthesis of secondary metabolites
gtn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gtn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GTNG_2571 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gtn01007]
    GTNG_2571 (hemL)
Enzymes [BR:gtn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     GTNG_2571 (hemL)
Amino acid related enzymes [BR:gtn01007]
 Aminotransferase (transaminase)
  Class III
   GTNG_2571 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABO67916
UniProt: A4IRG2
Position
complement(2676286..2677575)
Genome map
AA seq 429 aa AA seqDB search
MRSYERSKAAYEEAVTLMPGGVNSPVRAFKSVGMTPIFMARGQGAKIYDIDGNEYIDYVL
SWGPLILGHADPQVVEALKRVAEQGTSFGAPTLLENELAKLVIERVPSVEIVRMVNSGTE
ATMSALRLARGYTKRNKIIKFEGSYHGHGDSLLIKAGSGVATLGLPDSPGVPQSVAQHTI
TVPYNDLDSVRYAFERFGEDIAAVIVEPVAGNMGVVPPVPGFLEGLRDVTKQYGALLIFD
EVMTGFRVDYHCAQGYYGVEPDLTCLGKVIGGGLPVGAYGGKAEIMEQVAPSGPVYQAGT
LSGNPLAMTAGYETLRQLTPETYKEFRRKAARLEEGLHQAAEKYEIPHTINRAGSMIGFF
FTNEPVINYETAKTSDLELFAAYYREMANEGIFLPPSQFEGLFLSTAHSDEDIEYTIAAA
ERVFARLRG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaagttatgaacggtcgaaagcggcttatgaagaagcagtgacattaatgccaggt
ggggtaaacagcccggttcgcgccttcaaatcggtcgggatgacgccgatttttatggcg
cgcggccaaggtgcgaaaatttacgatattgacggcaacgaatatatcgattatgtgttg
tcatggggaccgctcattttagggcatgccgatccacaagttgttgaagcgttaaaacgg
gtagccgaacaagggacgagcttcggcgctccgacgttgcttgagaacgagttggccaaa
ctcgtgatcgagcgggtgccttccgtcgagatcgtacgaatggtcaactccggaacggaa
gcaacgatgagcgccctccgtttggcgcgtggctacacgaagcgcaacaaaatcatcaag
tttgaaggcagctaccatggtcatggtgattcgttgcttattaaagctggctccggtgtg
gcgacgctcggcttaccggatagtccaggcgtaccgcaatcagtcgctcagcataccatc
accgttccgtacaatgatttggacagcgtgcgctatgcatttgagcggtttggtgaagac
attgcggcggtgattgtcgagccggtagccggcaatatgggcgttgttccgccagtccct
ggctttttggaagggctgcgcgacgtgacaaaacaatacggcgctctattgatttttgac
gaggtgatgaccggattccgtgtcgattaccattgtgcacaagggtattacggcgttgaa
ccggatttgacgtgcctcggcaaagtgatcggcggcggcctgccggttggagcgtatggc
ggtaaagcagaaattatggagcaagttgcaccgagcgggccggtgtatcaggccggtacg
ttgtccggcaacccgcttgccatgacagccggttatgaaacgcttcgccaactgacaccg
gaaacgtataaagagtttcgtcggaaggcagcgcgccttgaagaagggctgcatcaagct
gccgaaaaatatgagattccgcataccatcaaccgcgctggatcgatgattggctttttc
tttacgaacgagccggtcatcaattacgagacggcaaaaacgtcggatttggaactgttt
gccgcctattaccgggagatggcgaacgaaggcattttcttgccgccgtcacaatttgaa
gggctgtttttgtcgactgctcatagcgatgaagacattgaatatacgatcgccgctgcc
gagcgggtatttgctcgtctgcgcggctaa

DBGET integrated database retrieval system