KEGG   Geobacillus thermodenitrificans: GTNG_2637Help
Entry
GTNG_2637         CDS       T00496                                 

Definition
(GenBank) Peptidase M42 family
Organism
gtn  Geobacillus thermodenitrificans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ABO67982
UniProt: A4IRM8
Position
complement(2746475..2747560)
Genome map
AA seq 361 aa AA seqDB search
MAKLDETLTMLKALTDAKGVPGNEREAREVMKTYIAPYADEVTTDGLGSLIAKKEGKAGG
PKVMIAGHLDEVGFMVTQIDDKGFIRFQTLGGWWSQVMLAQRVTIVTKKGDITGVIGSKP
PHILPPEARKKPVDIKDMFIDIGAKSRDEAMEWGVRPGDMIVPYFEFTVLNNEKMLLAKA
WDNRIGCAIAIDVLKQLKGVDHPNTVYGVGTVQEEVGLRGARTAAQFIQPDIAFAVDVGV
AGDTPGVSEKEAMGKLGAGPHIVLYDATMVSHRGLREFVIEVAEELNIPYHFDAMPGGGT
DAGAIHLTGSGVPSLTIAIPTRYIHSHASILHRDDYENTVKLLVEVIKRLDADKVNQITF
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattggacgaaacgttaacaatgctgaaagcgttgacggatgcaaaaggtgtc
ccgggcaatgaacgggaagcgcgcgaagtgatgaaaacatacatagccccatatgcggac
gaagtaacgaccgacggtctcggcagcttgatcgccaaaaaagaaggaaaagctggcgga
ccgaaagtcatgattgccggccatttggacgaagtcggctttatggtcacgcaaatcgat
gataaaggattcatccgcttccaaacgctcggcggctggtggagccaagtgatgctcgcc
caacgagtgaccatcgtaacgaaaaagggcgacatcaccggtgtgatcggttcgaagccg
ccgcacattttgccgccggaggcgcgcaaaaaaccggttgatattaaagatatgttcatt
gacatcggtgcgaagagccgtgacgaagcgatggagtggggcgtccgcccaggcgatatg
atcgtaccgtattttgagtttaccgtgttgaacaatgaaaaaatgctgttagccaaagcg
tgggacaaccggatcggctgtgcgatcgccattgatgtgctcaagcagctgaaaggcgtt
gaccacccgaacacggtgtatggtgtcggcacggtacaggaagaagtcggtttgcgcggg
gcgcgcacggctgcccaattcattcaaccggacatcgcttttgccgttgacgtcggcgtg
gcaggcgatacgccaggtgtctcggaaaaagaagcgatgggcaagctcggcgccggcccg
cacattgtcctatacgatgcaacgatggtgtcgcatcgcggtttgcgcgaatttgtcatc
gaagtggcggaagagctgaacattccgtatcactttgacgccatgccaggcggcggcacg
gacgcgggggcgattcatttaaccggcagcggtgtcccgtcactgacgattgccattcca
acccgctacatccattcgcatgcttccattttgcatcgcgatgactatgaaaacacggtc
aagctattagttgaagtcattaaacggcttgatgctgataaagtgaaccaaattacattt
gaataa

DBGET integrated database retrieval system