KEGG   Geobacillus thermodenitrificans: GTNG_2696Help
Entry
GTNG_2696         CDS       T00496                                 

Definition
(GenBank) Acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00010  Glycolysis / Gluconeogenesis
gtn00620  Pyruvate metabolism
gtn00640  Propanoate metabolism
gtn00680  Methane metabolism
gtn01100  Metabolic pathways
gtn01110  Biosynthesis of secondary metabolites
gtn01120  Microbial metabolism in diverse environments
gtn01130  Biosynthesis of antibiotics
gtn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTNG_2696
   00620 Pyruvate metabolism
    GTNG_2696
   00640 Propanoate metabolism
    GTNG_2696
  Energy metabolism
   00680 Methane metabolism
    GTNG_2696
Enzymes [BR:gtn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     GTNG_2696
Lipid biosynthesis proteins [BR:gtn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   GTNG_2696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABO68041
UniProt: A4IRT7
Position
complement(2804377..2805972)
Genome map
AA seq 531 aa AA seqDB search
MKREELIAPERYNLTSEMERHAAAHPERIALKWENERGETKEITYGRLMARANQIGNAFL
SRRLEKGDKVLVMVPRLIEAYEVYLGALKAGLVVIPSSEMLRTKDLEYRLSHGEVKAIVA
YEPYLDEFAPIDGVDKLLKFSIGEHEHDGWVRLDAAMAAESETLAAADTSRDDMAFLSYT
SGTTGNPKGVVHCHGWAYAHLRTAAKNWLCIEETDLVWATAGPGWQKWIWSPFLSVLGSG
ATGFVYYGRFEPEKYLQLLEKYQVNVLCCTPTEYRLMAKVPDIGRYDLSHLHSAVSAGEP
LNREVIDTFAKHFGIQVRDGYGQTENTLLVGVMKGMDIKPGSMGKPTPGNRVEIIDENGE
PCPVGVVGDIAVHVETPALFKYYYKDPERTAMQFRGDYYITGDKARKDENGYFWFEGRGD
DIIISSGYTIGPFEVEDALVKHPAVKECAVVASPDEVRGHVVKAFVVLRDGVDPNDPSLI
PALQEHVKQLTAPYKYPRKIEFVDDLPKTVSGKIRRVELREREARLAGRSS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgggaagaactgatcgctcctgagcgctacaatttaacgtccgaaatggaacgg
catgcggcagcacatccggagcgaattgctttaaaatgggagaatgagcgcggcgaaacg
aaagagattacatacggtcgcctcatggcgcgcgctaaccaaattggaaacgctttctta
tcgcgcaggctggaaaaaggggataaagtgcttgtcatggttccgcggctgattgaagcg
tatgaagtatatttaggggcgctcaaagccgggcttgtcgtcatcccaagctcggagatg
ctgcggaccaaagacttggaataccgattgtcccatggagaagtgaaggcaatcgttgcc
tatgaaccgtatctcgacgaattcgctccgatcgatggcgtggacaagctgttgaaattt
tcgatcggtgaacacgagcatgacggttgggttcggttggacgcggcgatggcggcggaa
agcgaaacactcgcagcggccgacacatcgcgcgacgatatggcgtttttatcttacaca
tctggaacgaccggcaatccgaaaggggtcgtccattgccacggctgggcgtacgcccat
ttgcgcacggcggcgaaaaactggctgtgcattgaagagacggatctcgtttgggcgacc
gctggaccagggtggcaaaaatggatttggagcccatttttatcggtgctcggttcggga
gcgaccgggtttgtctattacggccgctttgagccggaaaaatatttgcagctgttagaa
aaatatcaggtcaacgtgctttgctgcacaccgaccgagtaccgtctgatggcgaaagtg
ccggatatcggccgctacgacttatcgcatttgcacagcgccgtctcggctggtgagccg
ctcaaccgtgaagtgatcgacacgtttgccaaacattttggcatccaagtgcgcgacggt
tatggacagacggaaaatacattgcttgtcggtgtcatgaaggggatggacatcaaaccg
ggatcgatggggaaaccgacgccgggcaaccgtgtcgaaattatcgacgaaaacggcgaa
ccgtgcccagtcggcgttgtgggagatatcgctgttcatgtagaaacgccagccttattt
aaatattactataaagatccggaacggacggcgatgcagttccgcggtgactattacatt
accggcgataaggcgagaaaagacgaaaacggttatttctggtttgaaggccgcggcgat
gatatcatcatcagctccggttatacgatcggcccgtttgaagtggaagatgcgctcgtc
aagcatccggcggtaaaagaatgcgcggttgtcgccagcccggatgaagtgcgcggtcat
gtcgtcaaagcgttcgtcgtgctccgtgatggagtcgatccaaacgatccatcgctcatt
ccggcgctgcaggaacatgtcaaacaattgaccgctccatacaaatatccgcgcaaaatt
gagttcgtcgatgacttgccgaaaaccgtgtcgggaaaaatccgccgcgtcgagcttcgc
gagcgggaagcgcgccttgcaggccgctcttcttaa

DBGET integrated database retrieval system