KEGG   Geobacillus thermodenitrificans: GTNG_3200Help
Entry
GTNG_3200         CDS       T00496                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00040  Pentose and glucuronate interconversions
gtn00052  Galactose metabolism
gtn00500  Starch and sucrose metabolism
gtn00520  Amino sugar and nucleotide sugar metabolism
gtn01100  Metabolic pathways
gtn01130  Biosynthesis of antibiotics
Module
gtn_M00362  Nucleotide sugar biosynthesis, prokaryotes
gtn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GTNG_3200
   00052 Galactose metabolism
    GTNG_3200
   00500 Starch and sucrose metabolism
    GTNG_3200
   00520 Amino sugar and nucleotide sugar metabolism
    GTNG_3200
Enzymes [BR:gtn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GTNG_3200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: ABO68545
UniProt: A4IT91
Position
complement(3306569..3307453)
Genome map
AA seq 294 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAMASGIEDIIIVTGKG
KRAIEDHFDHAFELEQLLKQKGKLDLLEKVKEPSKVDIHYIRQKEPKGLGHAVWCARSFI
GDEPFAVLLGDDIVQAETPCLKQLIDQYEQTFSSVIGVKRVPEEETHRYGIIDPLEQRGR
RYQVRRFVEKPAPGTAPSNLAIVGRYVLTPEIFLFLEKQEVGAGGEIQLTDAIGRLNEIQ
RVFAYEFEGKRYDVGEKLGFIETTIEFALQNKELRDDLLSFLERMVTEAKGSAE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtgcgcaaagcgatcattcctgcggcagggcttgggacgcgatttttgccg
gcgacaaaggcgatgccgaaggagatgcttccgattgtcgataagccgacgattcaatat
attgtggaagaggcgatggcatcaggcattgaagacattatcatcgtcaccgggaaaggg
aagcgggcgattgaagaccatttcgaccatgcgtttgagctcgagcagctgctcaagcaa
aaagggaagctcgatttgttggaaaaagtgaaagagccatccaaagtagacatccactac
attcgccaaaaagagccgaaaggattagggcatgcggtgtggtgcgcccgcagtttcatc
ggggatgaaccgtttgcggtgttgttgggtgacgacatcgttcaagcggaaacgccgtgc
ttaaagcagctcattgatcaatacgagcaaacattcagctcggtgatcggcgtcaagcgt
gtgccggaggaagagacgcaccgttacgggatcatcgatccgctcgagcagcggggccgc
cgctaccaagtgcgtcgttttgtcgaaaaaccggctccaggcacggcgccgtccaatttg
gcgatcgttggccgttatgtattgacgccggagattttcttgtttttagagaagcaagaa
gtcggtgcgggtggggagattcagctgaccgatgcgatcgggcggctcaatgaaattcag
cgtgtcttcgcctatgagttcgaagggaaacggtacgatgtcggggagaagctcggcttt
atcgaaacgacgatcgagtttgccttgcaaaacaaggagctgcgcgacgatttgctttcg
tttttagagcggatggtgacagaggcgaaaggatcggctgagtga

DBGET integrated database retrieval system