KEGG   Gloeophyllum trabeum: GLOTRDRAFT_114422Help
Entry
GLOTRDRAFT_114422 CDS       T03130                                 

Definition
(RefSeq) hypothetical protein
  KO
K12733  peptidyl-prolyl cis-trans isomerase-like 1 [EC:5.2.1.8]
Organism
gtr  Gloeophyllum trabeum
Pathway
gtr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:gtr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    GLOTRDRAFT_114422
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gtr03041]
    GLOTRDRAFT_114422
   03110 Chaperones and folding catalysts [BR:gtr03110]
    GLOTRDRAFT_114422
Enzymes [BR:gtr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     GLOTRDRAFT_114422
Spliceosome [BR:gtr03041]
 Complex B
  Other components
   Prp19-related factors
    GLOTRDRAFT_114422
 Complex C
    GLOTRDRAFT_114422
Chaperones and folding catalysts [BR:gtr03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    GLOTRDRAFT_114422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 19299877
NCBI-ProteinID: XP_007863139
JGI: Glotr1_1_114422
UniProt: S7QD44
Position
Unknown
AA seq 156 aa AA seqDB search
MESVVLETSMGDIQLELYWNHAPRTCKNFAELARRGYYNGVIFHRVIADFMVQGGDPTGT
GRGGTSIYGQKFEDEIHPELRFTGAGILAMANSGPNTNGSQFFLTLAPTPYLDNKHTIFG
RVSSGMRVLQRLGAVATDAQDRPTEDVKIHRARVVS
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggagtcagtagttctggaaacgagcatgggcgacatccaactggaactgtattggaac
catgccccacggacatgcaagaacttcgcggaactagcgcgacgtgggtactacaatggg
gttatctttcatcgagttatcgcagacttcatggtgcaaggaggcgaccccactggtacg
ggcaggggtggtacgagtatctacggacaaaaattcgaagatgaaattcatcctgagcta
cgattcacgggagcaggcatccttgcgatggccaactcaggccccaatacaaatggttcc
cagttcttcttaaccctggcgccaacaccttatctggacaacaagcataccatcttcggg
cgagtaagttctggaatgcgggttctccagcggctaggcgccgtcgcaaccgacgcgcaa
gacagaccgacggaagacgtcaagattcacagggctcgggttgtgtcttga

DBGET integrated database retrieval system