KEGG   Gloeophyllum trabeum: GLOTRDRAFT_115535Help
Entry
GLOTRDRAFT_115535 CDS       T03130                                 

Definition
(RefSeq) amidase signature enzyme
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
gtr  Gloeophyllum trabeum
Pathway
gtr00970  Aminoacyl-tRNA biosynthesis
gtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GLOTRDRAFT_115535
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gtr03029]
    GLOTRDRAFT_115535
Enzymes [BR:gtr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     GLOTRDRAFT_115535
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     GLOTRDRAFT_115535
Mitochondrial biogenesis [BR:gtr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GLOTRDRAFT_115535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 19300055
NCBI-ProteinID: XP_007864947
JGI: Glotr1_1_115535
UniProt: S7RNS9
Position
Unknown
AA seq 474 aa AA seqDB search
MKLARSLHTRAAKTNALVYTPPTPPPARPGPLSGTRVAVKDNICTRDMPTTCSSEMLRDF
TSPFDATVVSLLRAAGAQIVGKANCDEFGMGSLNVHSIHGPVLNPWVPRDEHEHAPRSAG
GSSGGSAAAVAAGLCDVALGTDTGGSVRLPAAYCGVVGLKPSYGLLSRWGVVSYSDSLDC
VGVLARSVADVHKVFATLNHHDPRDPTSLPPSIRQRARSAPARGRDPSDLRGLTIGIPQE
YFPAELPALPLRPLLRALRARGAALVPVSLPSTRFALSAYYVIASAEAGSSLGRFDGVRY
GKHVPPPPGADRAKASQVYAHSRTKGFGREVRKRVLLGTYALSADAFDNYFLQAQRVRRL
IKADFDRVFLKPNPLRGSPSRSDEREEEGKVDVLLHPSAMRTAPPLPAPSPATHLDAYVQ
DTLTTPASLAGLPALSVPAGLADGWPVGVSVVGQWGDEEGVLGVGRVVEAVVGM
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgcgcgctccctccacacccgcgccgccaagaccaatgcgctcgtctacacg
ccgccgacgcccccgcccgcccgcccggggccgctgagcgggacgcgggtcgcggtgaag
gacaacatctgcacgcgcgacatgcccacgacgtgttcgtccgagatgctccgcgacttc
acctccccgttcgacgccaccgtcgtctccctcctgcgcgccgccggcgcccagatcgtc
ggcaaagccaactgcgacgagttcggcatgggctcgctcaacgtccactccatccacggg
cccgtcctcaacccctgggtgccacgcgacgaacacgaacacgccccgcggagcgcgggc
ggcagctcgggcgggtcggccgctgctgtagccgctgggttgtgcgacgtcgcgctcggc
acggacacgggcggctccgtccgcctccccgcggcctactgcggggtagtcgggctcaaa
ccgtcctatgggctgctgagcaggtggggcgtcgtctcctactccgactcgctcgactgc
gtcggcgtcctcgcgcgctccgtcgccgacgtccacaaagtgttcgcaaccctaaaccac
cacgacccgcgcgaccccacctccctcccgccctccatccggcagcgcgcgcgttccgcc
cccgcgcgggggcgggacccctccgacctgcgcgggctcacgatcgggattccgcaggaa
tacttccccgccgagctccccgccctccccctccggcccctcctccgcgccctgcgcgcg
cgcggcgccgccctcgtccccgtgtccctccccagcacgcgcttcgccctgagcgcgtac
tacgtgatcgccagcgcggaggcggggagcagtttggggcggttcgacggggtgcgctac
ggtaaacacgtccccccgccccccggcgcggaccgcgccaaagcgagccaggtatatgcc
cactcgcggaccaaaggcttcgggagggaggtccggaagcgggtgttgttggggacgtac
gcgttgagtgcggacgcgttcgacaactacttcctgcaagcgcagcgcgtccggcggctc
atcaaggcggacttcgaccgcgtcttcttgaagccgaacccgctccgcgggtccccatca
cgctcggatgaacgcgaagaggaaggcaaagtcgacgtcctcctgcacccctccgcgatg
cgcaccgcgccgccgctccccgccccctcccccgcaacacacctggacgcgtacgtccag
gacacgctcaccacgcccgcctccctcgccgggctgcccgcgctcagcgtccccgcgggc
ctggccgacggctggccggtcggcgtgagcgtcgtggggcagtggggcgacgaggagggc
gtgctgggcgtggggagggtggtggaggcggtggtggggatgtga

DBGET integrated database retrieval system