KEGG   Gloeophyllum trabeum: GLOTRDRAFT_124895Help
Entry
GLOTRDRAFT_124895 CDS       T03130                                 

Definition
(RefSeq) hypothetical protein
  KO
K03000  DNA-directed RNA polymerase I subunit RPA12
Organism
gtr  Gloeophyllum trabeum
Pathway
gtr03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:gtr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    GLOTRDRAFT_124895
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gtr03021]
    GLOTRDRAFT_124895
Transcription machinery [BR:gtr03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     GLOTRDRAFT_124895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_C RNA_POL_M_15KD DZR Mu-like_Com UPF0547 IBR DNA_RNApol_7kD Zn_Tnp_IS1595 OrfB_Zn_ribbon zf-ribbon_3 Baculo_LEF5_C DUF523 HypA DUF3268 zf-NADH-PPase zinc_ribbon_2 Cytochrom_CIII Ogr_Delta zinc_ribbon_5
Motif
Other DBs
NCBI-GeneID: 19301154
NCBI-ProteinID: XP_007861600
JGI: Glotr1_1_124895
UniProt: S7S1V5
Position
Unknown
AA seq 128 aa AA seqDB search
MPTPRLAEKIGSLLFCPDCGTLLNLPRDDEVVVNCEQCGHEEPASSYENIVITTRSHPDA
FPSALRQKGKTQTKVHQGDEALLKVTEKCPECGHMEAYSKEMQLRSADEGSTILYTCVNC
KHGWRVNN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgcctcgtctggcagaaaagatagggtcgctgctgttttgccctgactgcggg
accttgcttaacctgccccgcgatgatgaggtcgtggtgaactgcgagcaatgcggacat
gaagaacccgccagctcatacgagaacatcgtcatcactactcggtcacatcctgatgcg
ttcccgtctgcgctgagacagaaggggaagacgcagaccaaagtgcaccagggggacgaa
gccttgcttaaggttacggagaagtgccccgagtgcggacacatggaggcgtattccaag
gagatgcagctgagaagcgccgacgaaggatctacaatcttgtacacgtgcgtgaactgc
aagcacggctggcgtgtcaacaactga

DBGET integrated database retrieval system