KEGG   Gloeophyllum trabeum: GLOTRDRAFT_34364Help
Entry
GLOTRDRAFT_34364  CDS       T03130                                 

Definition
(RefSeq) Glutamyl-tRNA Gln amidotransferase B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
gtr  Gloeophyllum trabeum
Pathway
gtr00970  Aminoacyl-tRNA biosynthesis
gtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GLOTRDRAFT_34364
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gtr03029]
    GLOTRDRAFT_34364
Enzymes [BR:gtr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     GLOTRDRAFT_34364
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     GLOTRDRAFT_34364
Mitochondrial biogenesis [BR:gtr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GLOTRDRAFT_34364
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 19305552
NCBI-ProteinID: XP_007861756
JGI: Glotr1_1_34364
UniProt: S7QGC4
Position
Unknown
AA seq 503 aa AA seqDB search
MRLSCLHRRLQFGRLFSTVTGSHGDRRWPGWEVVVGLEVHAQIKSRSKLFSSKLWTSDPS
EPPNTSVSAYDAAFPGTLPRLNPKSVDLVLRTAIALHSEIQRRSAFDRKHYFYADLPAGY
QITQHYAPIATGGHLDLAAGRSVRIKQIQIEQDTGKSTYDARRRVSLIDLNRAGTGLMEI
VSEPDMRSPEEAGTYLRTLQALLRSVGSSDGNMEQGSLRCDVNVSVNKPGEPLGTRCEIK
NLNSVKFMQVAIACEVFRQIELLEKGEAVQQETRGFDEAAARTFSLRSKEDAPDYRYMPD
PNLPPLLLEQAYIDRIRSTMPELPDATRARLICQGLTSRDADVLMSVDAGREVGFDGQLG
EGAVALTHDLLGQLTARNLTFKENPISTGQLGDLIDLVQKGLLTGTSGKTLLRYMLDHRT
QEMPSQLARDMSLLALPADADNGTSELEGWCREAMDALPSETAAARQGNRNVVNKLVGRV
MKISRGRANALKAKEVIESMLRA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgagctgcctccatagaaggcttcaatttggccgtctcttttccaccgtaaca
ggtagccatggtgaccgtaggtggccaggatgggaggtggtggtgggcttagaagtacac
gcgcaaataaaatcacggtcgaagttattctccagtaagctctggacatctgatcctagt
gaaccgccgaacacgtctgtgtctgcatacgacgcagcgttccctgggacattaccgaga
ttaaatccgaagtccgttgaccttgtgttgaggacagcgatagcgctgcattccgagata
cagcgacgttctgctttcgatagaaagcattacttctatgccgatctacccgctggttat
cagataacacagcactatgcgcctattgcgacaggcggccatctcgatctagcggcaggt
cgttctgtccgcataaaacagatacagatagaacaggacactggaaaatcaacgtatgat
gctagaagacgagtatcgttgattgaccttaacagggcgggtacaggactcatggaaatc
gtctccgagccagatatgcgctctcccgaggaagctgggacgtacttgcggacgctgcag
gcactcctgcgttccgtcggatcgagcgacggaaacatggagcagggctcccttcgctgc
gacgtgaacgtctcggtcaacaaaccaggcgagcccctggggacgcgctgcgagatcaag
aacctcaacagcgtgaaattcatgcaggtcgcaatcgcatgcgaagtctttcgccaaatc
gagctcctcgagaaaggggaggccgtgcagcaggagacgcgcgggttcgacgaagccgct
gcgcggacgttctccttgcgcagcaaagaggacgcgcctgactatcggtacatgcccgac
ccaaatctaccgccattgctcctggagcaggcatacatagaccggatacgctccacgatg
cccgagcttcccgacgcgacgcgagcgcggctcatctgccagggcctcacgtcgcgagat
gcggatgtgctgatgtctgtggacgctggtcgggaagtcggcttcgacggacagcttgga
gaaggcgcggtagcgttgacccatgatttgctgggacagttgacggcgagaaacttgacg
ttcaaagagaaccccatctctaccggccaattaggggatctgattgatttggttcagaag
ggccttttgacgggaacgtcggggaagacccttctccgctacatgctcgaccatcgaaca
caagaaatgccctcacaacttgcgcgcgatatgtcgctgctcgctcttcccgcggacgcg
gacaatggcacatcggaactggaaggctggtgccgggaggctatggatgcactgccgtca
gaaaccgcagcggcgagacaagggaaccggaatgtggtaaataagctcgttggtcgggtg
atgaagattagtcgagggagggctaatgcactgaaagcgaaggaagttattgagagtatg
ctacgtgcttaa

DBGET integrated database retrieval system