KEGG   Gloeophyllum trabeum: GLOTRDRAFT_52874Help
Entry
GLOTRDRAFT_52874  CDS       T03130                                 

Definition
(RefSeq) succinyl-CoA-ligase
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
gtr  Gloeophyllum trabeum
Pathway
gtr00020  Citrate cycle (TCA cycle)
gtr00640  Propanoate metabolism
gtr01100  Metabolic pathways
gtr01110  Biosynthesis of secondary metabolites
gtr01130  Biosynthesis of antibiotics
gtr01200  Carbon metabolism
Module
gtr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gtr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GLOTRDRAFT_52874
   00640 Propanoate metabolism
    GLOTRDRAFT_52874
Enzymes [BR:gtr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     GLOTRDRAFT_52874
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GLOTRDRAFT_52874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 19306903
NCBI-ProteinID: XP_007860371
JGI: Glotr1_1_52874
UniProt: S7RZU6
Position
Unknown
AA seq 331 aa AA seqDB search
MLSRTGRSLTSSVGRRAFSQSAARKSYDDTIANLRIHKDTKVLCQGMTGKTGTFHVREAL
AYGTKMVGGVSPKKAGQTHLGLPIFGSVKEAVRETQPDATVLYVPPPTAADAILEAIENE
IGLIVCITEGIPQADEIKVMHALRSQSKSRLVGPNCPGIINPEGCKMGIQPGHIHKPGKI
GIVSRSGTLTYEAVAQTTDVGLGQSLCVGVGGDPFPGTKHVDVIKVFLDDPKTEGIVIIG
EIGGSMEEEAAEYLEQYNKTRSNPKPVVGFIAGRTAPPGRRMGHAGAIIAGGKGAAGDKI
AALQKAGVNVVDSPAMIGPKMLEIMKAAGLA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcccgtactggccggtcgctgacgagcagcgtcgggcgtcgggctttctcgcaa
tccgcggcgcggaagagttatgatgataccatcgcgaatttgcgcatacacaaagacacc
aaggtcctatgtcagggcatgacaggaaagactggtactttccatgtccgagaggctttg
gcgtacggaacgaagatggtgggcggtgtgtctcctaagaaagccgggcagacgcatctg
ggtttacccatctttggctcggtgaaggaggcggtccgggagacgcaaccagacgcgacg
gttctatacgttcctccacctactgcagccgacgccattcttgaagccatcgagaacgag
attggtcttattgtgtgcatcaccgaaggcatcccacaagcggatgagataaaggtcatg
catgcgctgaggagtcagtcaaagtcgcgtttagttggacccaattgccctggtatcatc
aacccggaggggtgcaaaatgggcatccaaccaggtcatatccataagcctggcaaaatt
ggaattgtctcccgctccggtactttgacgtacgaggctgtggctcagactaccgatgtt
ggattgggccagtccttatgcgttggcgtcggcggtgacccattccctggaaccaagcat
gtcgatgtcatcaaggtgttccttgacgaccccaagactgagggtatcgtcatcatcggt
gaaatcggtggtagcatggaggaagaagctgcggagtacctggaacaatacaacaagact
cgcagtaatccaaagcccgtagtcggctttattgctggccgcacagcgcctccaggtcgc
cgaatgggacatgcaggtgcaattatcgctggcggcaaaggagccgccggagataagatt
gcggccctgcagaaggccggggtgaacgtcgtagacagtcctgcaatgatcggtccgaag
atgctcgagatcatgaaggcggcaggcttggcctaa

DBGET integrated database retrieval system