KEGG   Gloeophyllum trabeum: GLOTRDRAFT_62003
Entry
GLOTRDRAFT_62003  CDS       T03130                                 

Definition
(RefSeq) ERG4/ERG24 ergosterol biosynthesis protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
gtr  Gloeophyllum trabeum
Pathway
gtr00100  Steroid biosynthesis
gtr01100  Metabolic pathways
gtr01110  Biosynthesis of secondary metabolites
Module
gtr_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:gtr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    GLOTRDRAFT_62003
Enzymes [BR:gtr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     GLOTRDRAFT_62003
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 19307458
NCBI-ProteinID: XP_007866990
JGI: Glotr1_1_62003
UniProt: S7Q3Z0
Position
Unknown
AA seq 437 aa
MAVEKRSSDLNPRTTSYEFFGPPGALFVTVTVPLTAYGLYFTCSEAAGGCPPPFDNLFVG
AVRAYNDLSWWKNLWDTEAALIYLAWYLFCVAAWFILPGDWVEGTQMRNGRKLKYKINAF
STLLLTLGVASGYVLRYGPESFTFIYDKWLGFVTASLLMSVLQATYCYVSSFYGDKLLAL
GGNSGNFIYDFFIGRELNPRIGSFDIKSFNELRPGLILWVLIDISMACEQAVRRGGSLLN
ITDSMWLVLAFHSFYVIDSLYNEPAILTTMDITTDGFGFMLAVGDLTWVPFTYSLQARYL
AFQQVELGPIWTAAIIAVNGLGYWIFRDSNGEKNDFRNGQNPKNLKYFETKRGTKLLTSG
WWGLSRHPNYLGDWLMAVAWCLPTGFDTPITYFYPVYFAVLLIHRQQRDDENCEKKYGED
WHKYKEMVPYRIIPYVY
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggctgtcgaaaagcgctcttccgacctcaacccgcgcacgacaagctacgagttcttt
gggccgcccggcgcgctcttcgtcaccgttaccgtccctctcaccgcatatggcctgtac
tttacgtgttcagaggcagcgggcgggtgcccccctcccttcgacaacctcttcgtaggc
gccgtgcgcgcctacaatgatctctcatggtggaagaacctctgggacaccgaagccgcc
ctcatctacctcgcctggtatctattctgcgtggccgcctggtttatcttgccgggagac
tgggtggaaggcactcagatgcggaacggtcggaagctaaagtacaagatcaatgccttc
tccacgctcctgcttacgctcggggtcgcctctgggtacgtcctccgctacggccccgag
tcgttcacgttcatctacgacaaatggctcggctttgtcaccgcctccctgctcatgtcc
gtgctgcaagccacctactgctacgtctcctccttctacggcgacaagctcctcgctctc
ggcggtaacagcggcaacttcatctacgacttcttcatcggccgcgagctgaaccccagg
atcggctcgttcgacatcaagtccttcaacgagctccggcccgggctcatcctctgggtg
ctcatcgacatcagcatggcctgcgagcaagccgtgcgcaggggaggtagcctgctgaat
atcacggattcgatgtggctcgtcctcgccttccactccttctacgtcatcgactcgctg
tacaacgagcctgccatcctcaccacgatggatatcacgacggatggcttcggcttcatg
ctcgcggtcggcgacctcacctgggtgcccttcacctactccctgcaggcgcgctacctc
gccttccagcaagtcgagctcggccctatctggacagccgccatcatcgctgtgaacggc
cttggctattggatcttcagggactcgaacggcgagaagaatgacttccggaacgggcag
aaccccaaaaatctgaagtacttcgagacgaagcggggtacgaagctactcacctccggc
tggtggggattatctaggcaccccaactacttgggtgactggctgatggctgtagcatgg
tgtttaccgacgggctttgatacacccatcacctacttctatccggtgtactttgccgtc
ctgctcatccacaggcaacaacgtgacgacgaaaactgcgagaaaaagtatggcgaagat
tggcacaagtacaaggagatggtgccataccgtattattccctatgtctactag

DBGET integrated database retrieval system