KEGG   Guillardia theta: GUITHDRAFT_106094Help
Entry
GUITHDRAFT_106094 CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
gtt  Guillardia theta
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gtt01002]
    GUITHDRAFT_106094
Enzymes [BR:gtt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     GUITHDRAFT_106094
Peptidases and inhibitors [BR:gtt01002]
 Metallo peptidases
  Family M16: pitrilysin family
   GUITHDRAFT_106094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 17304851
NCBI-ProteinID: XP_005834989
JGI: Guith1_106094
UniProt: L1JIM8
Position
Unknown
AA seq 989 aa AA seqDB search
MTTIEPRRKPDSDHRAYRLIQLPNGLDCVLISDPETQTAAAAMAVAAGQLQDPPEVQGLA
HFCEHMLFLGNKKFPGESDFDSFCAQSAGYSNAWTSLDRTVYHFMLAHDRLYDALDRFSG
FFSAPLFLEDLTERELNAIDSENNKNLQEDSRREFQLWRSSSKDGHPVQRFGTGNYKTLH
DMPLETGTNIREHLLRFWEQNYSANIMKLSILGRESLDTLESWSRTLFSDVPNHKIEPLR
GVLKEDDPFTSSWKSLYHIVPVKERRKLVLYFPTDSTYPNFRQKPTRFLSHCLGHEGPGS
VLSLLKKKGWATDLGAGTATQSTHFALFEVSIKLTEEGMPHYEEVIDLVFQYINSCLRAT
NNDERRRIRHECEMLEELNFRFRNRVREDQFTEQLACNLTRYPREEVLCGPDLFYDPLDF
DALDALIDRHFNAKNLRIDLVAPLADQPLDGETEWAEETWYKTKYVRRDISPALIARWSD
RSIPCHPELHLPRANPYTPEQWELKGDLQCSTAPTKVIDTDTVQAWHVLDTTFGVPKASV
RIQISSFVGEKCARKAVSLRMLLELIQEVTNEEAYDAEEAGLVFDISNTSASSPCTGLRL
SFKGYDHKMPVLVSNMLSCIANFKVKDHESVFELVKQKTIVDYRNRRFQQSYFHCVTATN
QVLEHPFWSNEERLRELETLTGVEVQDFLKEFLDNLLIEAFIVGNFSAEEAVKMITESLS
PLQPKALEGDSKPCLCITQIPEGETWVHEELGPDPDAVDSAISVYYQIGERTVDIDVRLE
LLCQVMDKEMYAQLRTVEQLGYIVAAVETKKWGVCGLKCLVQSVQCPQHLEVRMENFFMC
FEKKLQEMPGEEYADHVESLITKKQERDRSVDRMCERLMTELCAHTFVFDRKEKEVAALR
AVTKESLIEFFRKYFSVHRAAVDACKAEGKEVHLSAESKGTIRRYAPGSNPYPAPDMGQA
SRGWGAAEQFVSEDVSALRQSASRLRVQK
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgactacaatagagccgagaaggaagccagattccgaccatagggcttaccgcctgatc
cagctacccaatggccttgactgtgtcctgatttccgaccccgaaactcaaactgcagca
gctgccatggcagttgctgctggacagcttcaagacccccctgaagttcaaggcctggct
catttctgtgagcacatgctcttccttggcaacaagaaattccctggagagtccgacttc
gacagcttctgtgcgcagagtgctggttactcaaacgcctggacgtctttggatcgcacc
gtgtatcacttcatgctggctcatgaccgcctgtacgatgccctcgatcggttttctggg
ttcttctctgcccccctcttcctcgaagatcttactgagcgcgagctgaatgccatcgac
tcggagaacaacaaaaatctacaagaagactcgaggagagagtttcagctatggcgatcc
tcaagcaaagatggccatcctgtccagcgttttggaactggaaactacaagacgttgcat
gacatgcctttggaaactggaacgaatattcgagaacatcttcttcgattctgggaacag
aactacagcgctaacatcatgaaactcagcatcttgggacgcgaaagcctcgacaccctg
gaatcatggagcaggacccttttctcggatgtccccaatcacaagatcgagccgctgagg
ggtgtcttgaaggaagacgatccttttaccagcagctggaaatctctctaccacatcgtc
ccagtgaaggagaggaggaagcttgtgctttacttcccgacagactccacgtatccaaat
ttccgccagaaaccgacaagatttcttagtcattgtcttgggcacgagggtccaggaagt
gtgctctcgcttctgaagaagaaaggatgggcaacagaccttggagctgggactgcaaca
cagtcgactcactttgccttgttcgaagtctccatcaagttgacggaagaagggatgccg
cattatgaagaggtgatcgacttggtgttccaatacatcaattcctgcctacgtgccacc
aacaacgacgagcggcgaagaatcaggcatgagtgcgagatgttggaggaactcaacttc
cgattccgaaatcgagtcagagaagatcagttcactgagcagcttgcgtgcaacttgacc
cgctacccacgagaggaggtgttgtgcgggccagaccttttctacgacccgctcgatttt
gacgcattggacgcattgatcgacagacatttcaatgcgaagaatcttcgaattgacctg
gtggctccccttgccgaccagcctctggatggtgaaacggagtgggcagaggagacatgg
tacaagaccaagtacgtcagacgtgatatctcccctgctctcattgctcgttggtccgat
cgctccatcccgtgccaccctgaattgcaccttccccgcgccaacccctacacaccggag
cagtgggagctcaagggagaccttcagtgctctaccgctcctaccaaggtgatcgacaca
gacacagtgcaagcatggcatgtgctggacaccaccttcggagttcccaaggcttctgtc
aggattcagatcagttcgtttgtcggagagaagtgtgcgaggaaagcagtgtctctcagg
atgttgttggagttgatccaagaggtcaccaacgaagaggcatacgacgcagaggaggcg
gggctggtgttcgatatatctaacacgtctgcctcttctccgtgcactggtctcaggctg
tcgttcaagggttatgatcacaagatgccggtcctcgtctccaacatgttgtcctgcatc
gccaacttcaaagtcaaggaccatgagagcgtgttcgagcttgtgaagcagaagacgatt
gtagactacaggaatagaaggttccagcagtcgtacttccactgcgtcactgcgaccaat
caagtcttggagcatcccttctggagcaacgaggaaaggctgagggagctggagactttg
acaggggttgaagttcaagatttcctcaaagaattcttggataatctgctgattgaagcg
ttcatagtcgggaacttctcagcggaagaagcagtgaagatgataacggagtcactctcc
ccgctgcagcccaaggccctggagggagatagcaagccttgtctctgcatcactcagatc
cccgaaggagagacttgggtgcatgaggagctgggccccgacccggatgcggtcgacagc
gcgatctcagtgtactatcagatcggggagaggaccgtcgacatcgacgtacgtctcgag
ctcctctgccaagtcatggacaaggagatgtacgcgcagctgaggacggtagagcagctg
gggtacatagtggccgcggtggagaccaagaagtggggagtttgcgggttgaagtgtctg
gtgcagtcggttcagtgccctcagcatttggaagttcgcatggaaaacttcttcatgtgc
ttcgagaagaagctccaagagatgccgggcgaggaatatgcggaccatgtcgagagtttg
atcaccaagaaacaagagagggacaggagcgtcgacaggatgtgcgagcgcctgatgacg
gaactttgcgcgcacacttttgtgttcgataggaaggagaaggaagtagccgcgttgaga
gctgtcacgaaggagagtttgattgagttcttccgcaagtacttctccgttcacagagct
gcagtagatgcttgcaaggctgagggcaaggaggtgcacctttctgctgagagcaaggga
acgatcagacgctatgctcctggctccaacccttacccggcgccagacatgggacaggcg
agtcgaggatggggggcagcggaacagttcgtgtccgaggacgtctcggctctgcggcag
tcggcctcacgcttgagggtgcagaagtga

DBGET integrated database retrieval system