KEGG   Guillardia theta: GUITHDRAFT_106101Help
Entry
GUITHDRAFT_106101 CDS       T02925                                 

Definition
(RefSeq) FKBP-type peptidyl-prolyl cis-trans isomerase
  KO
K09571  FK506-binding protein 4/5 [EC:5.2.1.8]
Organism
gtt  Guillardia theta
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gtt03110]
    GUITHDRAFT_106101
Enzymes [BR:gtt01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     GUITHDRAFT_106101
Chaperones and folding catalysts [BR:gtt03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    GUITHDRAFT_106101
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_11 TPR_12 TPR_8 TPR_17 TPR_14 TPR_19 TPR_7 PL48 TPR_9 bMG5 TPR_15 TPR_20 BTAD
Motif
Other DBs
NCBI-GeneID: 17304668
NCBI-ProteinID: XP_005834996
JGI: Guith1_106101
UniProt: L1JHP2
Position
Unknown
AA seq 543 aa AA seqDB search
MHMRLRGGGEVVDLTGDGGVLKEILVEGSGDELPQNNDDVCVHYEGTLQSDGSKFDSSRD
RNTPFTFKLGQGKVIKGWDKGVATMKRGEKAVFTIRSDYGYGAEGSGDKIPGNATLIFEV
ELLRWNEREITNDGGVYLKPLDKKGTGWRHPDRHDEVIVKYEGRYEGQPFTVSNDFEMIK
LGSPSSPLPPGVERAICKEMKKGSNALITCRSDYAFGEHGVPGKVPPNADVIYEVELKDW
NAIHDVAKDGGIIVKCLGQLDTYGPLCDDASKVTLHVEGKVLEDGKVFLGPAEKCITVGD
GEMPEGFERGLEKIKKGQNAIITLSPNYAYGEAGNEDMGVPANATVQYVVNVNEVTPTYQ
LQLKDKLAAAEKRKEQGNVFFKSEDLEKALNKYDKAFKLVQYEQGEGDEAEAVKNLKSTC
HTNKAAVLEKQGKLDECIAECTKSLDIKPTNVKALFRRGKAYCTQNRLEDATKDLKQALT
VDPENKAAKQQLLLDQKDKKVFGKMFAKPGALATEKPASAPKKEEPAKEEEKIEELGEDT
RIK
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgcacatgagacttcgaggaggaggagaagtggttgatctgaccggcgatggaggcgtc
ttgaaagagatccttgtggaaggctctggcgacgaactcccacagaacaatgacgatgtt
tgcgttcactatgagggaactctgcaatcggacggatccaagttcgattcttccagggac
agaaacacacccttcactttcaagctcggccaaggaaaagtcatcaaagggtgggacaaa
ggtgttgctaccatgaagagaggcgagaaggctgtgttcactatcagaagcgactacggt
tatggtgctgaaggtagtggcgacaagatcccagggaacgcaaccttgatcttcgaagtc
gagctcttgcgatggaacgagcgtgaaatcaccaacgatggaggagtgtacttgaaaccc
ctcgacaagaaaggaactggatggcgacatcctgaccgtcacgatgaggtcatcgtcaag
tacgagggacgctatgaaggacagcctttcactgtcagcaatgatttcgagatgatcaaa
ctcggatcgccaagctcacccctgccccctggagttgagagggctatctgcaaggagatg
aagaagggaagcaatgctttgatcacttgccgatcagactacgcttttggggagcatggc
gttccaggcaaagttccacctaatgcagacgtgatctacgaagtcgaattgaaagactgg
aatgctatccatgacgttgccaaggacggaggaatcattgtcaagtgccttggacagctg
gacacgtatggaccactctgtgacgacgcgtccaaagtcacattgcatgtggaaggcaag
gtcctcgaagacggaaaggttttcctggggccggcagagaagtgcatcactgttggagat
ggagagatgccggaagggtttgaacgcgggttggagaagatcaagaagggccaaaacgcc
atcatcaccctctcgcccaactacgcgtatggagaagcagggaacgaggatatgggggtc
ccggccaatgctactgttcagtatgtcgtgaatgtgaacgaggtgactcctacctatcaa
cttcaactcaaggacaagctggcagcagctgagaagaggaaggaacaaggaaacgtcttc
ttcaagagcgaggatctggaaaaggctctgaataagtacgacaaggcgttcaaacttgtt
cagtatgagcaaggtgaaggagacgaagctgaagctgtgaagaatctcaagagcacgtgt
cacaccaacaaggctgcagtccttgagaagcaagggaaactggatgagtgtatcgcggag
tgtaccaagtcgctagacatcaagccgaccaacgtgaaggctctgttccggagaggaaag
gcttactgcactcaaaatcgtctcgaggacgcaaccaaggacctgaagcaggccttgact
gtcgaccctgagaacaaagcagcgaagcagcagctgctccttgaccagaaggacaagaaa
gtgttcggaaagatgtttgcaaagcccggggccctagcgacagagaagcctgccagcgcc
ccaaagaaggaggagccggcgaaagaggaagagaagatcgaagagttgggagaggacacg
aggatcaagtaa

DBGET integrated database retrieval system