KEGG   Guillardia theta: GUITHDRAFT_108721Help
Entry
GUITHDRAFT_108721 CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
gtt  Guillardia theta
Pathway
gtt00010  Glycolysis / Gluconeogenesis
gtt00562  Inositol phosphate metabolism
gtt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GUITHDRAFT_108721
   00562 Inositol phosphate metabolism
    GUITHDRAFT_108721
Enzymes [BR:gtt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     GUITHDRAFT_108721
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     GUITHDRAFT_108721
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 SurA_N_3
Motif
Other DBs
NCBI-GeneID: 17302172
NCBI-ProteinID: XP_005832437
JGI: Guith1_108721
UniProt: L1JAW9
Position
Unknown
AA seq 495 aa AA seqDB search
MKARGSRADFFIILVLFFCTVCNSLQDKLSEHLGSKGPYIAPEGWTRPEVPSTCTPTMIT
GVFRHGSRNPSAKDIKKFEQLEDLLRRLSREINTTNDKLRWAQTWKNPFKEEDASMLVSL
GVEEHLGASAGPEAQSDMSHIATIRDIMFFAPPVMSDQQGVRMRLQEELSMSVGQACQEK
RKATQVQEQFLESKEVQDVVARVGSKLGLKETSKELKAKHVAAMFTLCAFEAGQMKESSR
FCSLLDEDDMSTMEYWDDLKHFYKKSYGLAMNAGMACPLLLHLVHVMKSRPPHKTAELLF
AHGETMLPLVTLLGLFQDPFQLNASTPLHLRRTRKFRSGRIIPMAANIVFVLHSCRQDSS
SPQDLRVLVMVNERPVKLAACSEEEGWLCPLDSLIRIISDRQDTPRKLLNDLLQSEGSKG
DSGKGKGVLEHICGFRQLPEEEEEGEQTLNEGMEDEKLQEADTSETRLASLIFIFFLLFS
SFSLLAFTAWFLSRL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaagggggtctagagcggatttcttcatcatcctcgttctcttcttctgcact
gtttgcaactctttgcaagacaagctaagcgaacatcttgggagcaaagggccttacata
gctcctgaaggatggacgcgaccagaagttccttcgacatgcactccgacgatgattaca
ggagtttttcgtcatggatcgaggaacccaagtgctaaggacatcaagaagttcgagcag
cttgaggaccttcttcgacggctgagcagagagatcaacactacgaatgacaagctccga
tgggcgcaaacctggaagaatcccttcaaggaggaggatgcgagcatgctggtctcgtta
ggagtggaggagcatttgggtgcgtcagcaggtcctgaggcgcaaagtgacatgtcgcac
attgctaccatccgcgacatcatgtttttcgctcctcctgtcatgagcgatcagcaagga
gtgcgcatgcgtttgcaggaggagctttcgatgtcagtgggccaggcgtgtcaggagaag
cgcaaggccacgcaggtacaggagcagttcctggagagcaaggaggtgcaagatgtcgtc
gccagagttggaagcaagttgggtctgaaggagacaagcaaagagctgaaggctaagcac
gtcgccgccatgttcaccctgtgcgcattcgaagctgggcagatgaaagagtcttcgcgc
ttctgctccctgcttgacgaggatgacatgtcgacgatggagtactgggatgatttgaaa
catttctacaagaaatcctatgggcttgcgatgaatgctgggatggcatgccctctcttg
cttcatctggtacacgtcatgaagtcgaggcctcctcacaagacagcagagcttctcttt
gctcacggagagaccatgctgcccctcgtgacgctcctcggcctcttccaagatcccttc
cagctcaacgcgtcgacgcccctccacctcaggaggaccaggaagtttcggagcgggagg
atcatccccatggctgccaacattgtcttcgttctgcacagctgccgacaagattcttcg
agcccccaagacctcagggtcttggtgatggtgaacgagcgaccggtcaagctcgcggcc
tgctcggaggaagagggctggttgtgcccgctggacagtctgatccggatcatcagcgat
cgacaagacacgcccaggaagctgctcaacgacttgctgcagtcggaggggagcaaagga
gacagcggcaagggaaaaggcgtgttggaacacatctgcgggttcaggcaactccctgag
gaagaggaagagggagagcagacgttgaacgaggggatggaggacgagaagctgcaagag
gcggacacctcagagaccaggctcgcttccttgatcttcatcttcttcctcctcttctcc
tccttctctctcttggccttcaccgcatggttcctcagccgcctctag

DBGET integrated database retrieval system