KEGG   Guillardia theta: GUITHDRAFT_114790Help
Entry
GUITHDRAFT_114790 CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K15631  molybdenum cofactor sulfurtransferase [EC:2.8.1.9]
Organism
gtt  Guillardia theta
Pathway
gtt00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GUITHDRAFT_114790
Enzymes [BR:gtt01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.9  molybdenum cofactor sulfurtransferase
     GUITHDRAFT_114790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_5 MOSC_N
Motif
Other DBs
NCBI-GeneID: 17295871
NCBI-ProteinID: XP_005826111
JGI: Guith1_114790
UniProt: L1IS85
Position
Unknown
AA seq 662 aa AA seqDB search
MATRGGSKKSEEASSISPRTKFTSIMLEAIRRARLAVLRHFHARESEYAVVFTSGCTQAI
KIVAENFRWAAGRSVFAYTVNNHNSVLGARQYAKSAGCAYHPIPHAQAAEVLESAAKDAD
EGSKEQTTFSLFAFPAECNFSGQKLDLSWTERVQAGALNQLLGCGGDTRWKVLLDAAKHA
STSPLRLDGEHKPDFITLSFYKMFGYPTGLGALLIRRESAACLEKKTFAGGTVLAARADD
DMFVLRESLHERLEDGTIPFLSIMAAELGLRHLEEIGMEGIEQHTWSLRDFFASELGKMR
HANGRKAAMVYGPPPSSPSSAVGSICCFNMLQPAGGLLDYSHVEELACLVGINLRTGSFC
NPGANKEMLGHTSEDVELFLREGKVCGDRRCVIGGKATGAVRVSFGYMSTFDDARRVLRF
LETNFVDKGEEEEQAGGAGAQDERIATVQELILFPIKSCAPQIVSSSSGWLLTSSGLFLD
RKAEPNMAHVQPSIVMEERAMMVRCLSKPELGTLRISLEEEDVDRMAGEGGGGGGGGGGG
GGGSLSSLGGMLFKGEIWGGRSTTRSFRVCGRKEVGLCYDKSVNEWFSKPPQPDRRSGSA
AILEEEKQAKTFHSHGGQLLMVSEESMYGLWQRLRAKHPSSSSSSSSRPRTPGGLGKLQG
QI
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggctactcggggaggctcgaagaagtcagaagaggcttcgagcatctccccaaggacg
aagtttacgtcgatcatgctggaagcaatcagacgagcgaggctggctgtactccgtcac
ttccatgcccgagagagcgagtacgctgtggtcttcacctccggctgtactcaggccatc
aagatcgtcgctgagaactttcgctgggcggcaggcaggagcgtctttgcgtacactgtc
aacaaccacaacagcgtccttggtgctcgccagtacgccaagagcgctgggtgcgcctac
catcccatcccgcatgctcaggctgctgaggtgctggaatcagccgcgaaggatgcggac
gagggcagcaaggaacagaccaccttcagcctgttcgcgttccccgctgagtgcaacttc
agcggtcagaagctagacctcagctggactgagagggtgcaagctggggctctgaaccag
ctgctggggtgtggaggcgacaccaggtggaaggtgctgttagacgccgctaagcacgcc
agcacatcgcctctccgtttggatggtgagcacaaacctgactttatcactctctccttc
tacaagatgttcggctatccgacggggctgggagctctgctgatcaggagggagtcggcc
gcgtgcctggagaagaagacttttgctggaggcaccgtcttggcggcgagagccgacgac
gacatgttcgtcctgcgagagagtctgcacgagaggctcgaggacggaaccatccccttc
ctctccatcatggcggcagagctcgggcttcggcacctggaggagatcgggatggagggg
atagagcagcacacgtggagcttgagggatttcttcgcctccgagctgggaaagatgagg
catgccaacgggaggaaggcggctatggtctacggacctccgccctcctctccctccagc
gccgtcggctcgatctgctgcttcaacatgctccagcctgctggagggctgcttgactac
tcgcacgtggaggagctggcgtgtctggtggggatcaacctgaggacggggtccttctgc
aacccaggcgcgaacaaggagatgctggggcatacaagcgaggacgtggagctgttcctg
agggaggggaaggtgtgcggggaccggaggtgcgtcatcggcgggaaggcgacaggggcg
gtgcgggtgtcgttcgggtacatgagcacgtttgacgacgcgaggagggtccttcggttc
ctggagacgaacttcgtagacaagggggaggaggaggagcaggcgggaggggctggcgcg
caggacgagaggatagcgacggttcaagagctgatcctgttccctatcaagtcttgtgct
cctcagatcgtttcctcttcctctggttggctcctcacctcctctggtctcttcctcgac
aggaaggcggagccgaacatggcgcacgtgcagccgtcgatcgtgatggaggagagagcc
atgatggtgcgatgcttgtccaagcctgagctgggcacgttgaggatcagcctggaggag
gaggacgtggatagaatggcaggagaaggaggaggaggaggaggaggaggaggaggagga
ggaggaggcagcttgtcgtcgttgggaggcatgctgttcaagggtgagatatggggaggg
aggtcgaccacaagatcgtttcgagtgtgcgggaggaaagaagtcggtctctgctacgac
aagtcagtgaacgagtggttcagcaagcccccgcagccagacaggaggagtggcagcgcc
gcgatcctcgaagaggagaagcaggccaagacctttcactcgcacggggggcaactgctc
atggtctcagaggagagcatgtacggcctctggcaacggctgcgagccaagcatccctcc
tcctcatcctcctcctcctcacgcccgaggactcctgggggtcttgggaagttgcaagga
cagatctaa

DBGET integrated database retrieval system