KEGG   Guillardia theta: GUITHDRAFT_117609Help
Entry
GUITHDRAFT_117609 CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
Organism
gtt  Guillardia theta
SSDB OrthologParalogGFIT
Motif
Pfam: Ins145_P3_rec CCDC154
Motif
Other DBs
NCBI-GeneID: 17292971
NCBI-ProteinID: XP_005823234
JGI: Guith1_117609
UniProt: L1IK07
Position
Unknown
AA seq 635 aa AA seqDB search
MSVNWVGSKARASAGMPDTERKHQNDMLSSKSNDELRYGDSIVLLAERIFGFLQASPMKN
EENQLLIRPIDASQGLRTSTVDLETFQVQTCHEYEAQDRLQEFLVKHGLHHPSDVARLDE
DQKAFLEEVQNLAEEEIKGNEERQLFHLGRPIRYGDPFQLLHVKTRLFVTLENHSIKVSL
STKFPSSSRSSFAFHLTEGQKGSQFIFDTPARLELGVSQEGVVRPGDAVVLESIAYEGKR
LSALKRQGENVWSIHASDDDPCELTIQVQAQAKPALSGSSLKYNSLSQATASAKKELEAS
LHVVEERRQGIAREMALLDMRLTDVNKGFDQMVLQMMLHFQELHQALEARENQLLSEARK
RIMEKVTYLKERREELSKANDEADNGIQFASKVLAMDNDVEMLQMQPHVMRRLSSVKGAV
HTSSLPTENLTFRYTYNERLIDSIGEHGEIFIGSAHEERAVPSSKRAARPSSAHAAARSS
EAEPPRPSSAIHDGGTKSTSKQKEKIGKQLQFWHGSDHPALGEWLSDLRQSGDSIRKSKS
ANDSYNKKTRISASFSGKTRGSKSTDRRETSMDGRRRAVDSSAAFDASMADLSLDSKSHR
QSSDIKRMHERMTLASMSKITPKRTSAPLRDYYEG
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcaactgggtgggaagcaaggcgagggcgagtgctgggatgcctgacaccgaa
agaaagcatcagaatgatatgctttcctccaagagcaacgacgagctcagatacggagac
agcatcgtgctgctggcagagcgcatctttggcttccttcaggcatcgccgatgaagaac
gaggagaaccagctgctcatacgaccgatcgatgctagccagggcctgagaacaagcacc
gtcgatcttgaaacgtttcaggtacaaacgtgtcacgagtacgaagcacaagacaggcta
caagaattccttgttaagcacggcttgcaccatccctccgatgttgcaaggcttgacgag
gaccagaaggcattcctcgaggaggttcaaaatctcgctgaggaggagatcaagggcaac
gaagagcgccagctgtttcatctcggccggccgatcagatatggagacccctttcagctt
cttcatgtcaagacccggctctttgtcacgctagagaatcacagcatcaaggtctccttg
tccaccaagttccccagctcgtcgaggagctcgttcgccttccatctcactgaggggcag
aagggaagccagttcatcttcgacactccagctcgtctagagctgggagtctcgcaggag
ggggtagttcgcccaggggacgcggtggtcctcgagtccattgcgtatgagggtaagagg
ctatcagcgctcaagagacagggagagaacgtctggtccatccacgcgtccgacgacgac
ccttgcgagctcaccatacaagtgcaggcgcaggcgaaaccagcactcagcggaagctct
ctcaagtacaactcgctttcacaggcgacagcgagcgcaaagaaggagctcgaggcgtcg
ctgcacgtggtagaagagcggagacaagggatcgctcgtgaaatggccctgctggacatg
cggctgacggacgtgaacaaagggtttgaccagatggttctgcagatgatgcttcacttc
caggagctacaccaggcgcttgaagcgcgcgagaaccaactgctctctgaggcgaggaag
aggattatggagaaagtcacctacctcaaggagaggagggaggagctgtccaaggccaat
gatgaagccgacaacggtatccagttcgcctccaaggtcctggctatggacaacgacgtg
gagatgctgcagatgcagccgcacgtgatgaggaggctgagctctgtcaaaggagccgta
cacacttcctccctccccacagagaacctgaccttccgctacacctacaacgaaaggctg
atcgactccatcggcgagcatggagaaattttcattgggagtgcgcacgaggagcgagca
gttccgtcgtctaagagagccgcgcgtccttcctcagcgcatgctgctgctcgatcgagt
gaggcagaacctccgaggccgtccagtgccatccatgatgggggcactaagagcacaagc
aagcaaaaggagaagatcggaaagcagctgcaattctggcatggctccgaccatccggct
cttggcgagtggctctcagatctgcgacagagcggagacagcatccgaaagagcaagagt
gccaacgactcgtacaacaagaaaacgcgcatctctgcttctttcagtgggaagacaaga
ggatccaagtcaacggacaggagagaaacgtcgatggatgggaggaggagagcagtagac
agttcagctgctttcgacgcgtccatggccgacttgtcgctcgactccaagagccatcgg
caaagctcggacatcaagaggatgcacgagagaatgacgcttgcttcaatgtccaagatc
accccaaagcggacaagtgcccctctccgagattactacgaaggataa

DBGET integrated database retrieval system