KEGG   Guillardia theta: GUITHDRAFT_118300
Entry
GUITHDRAFT_118300 CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
gtt  Guillardia theta
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GUITHDRAFT_118300
Enzymes [BR:gtt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     GUITHDRAFT_118300
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 17292248
NCBI-ProteinID: XP_005822466
JGI: Guith1_118300
UniProt: L1IGU8
Position
Unknown
AA seq 404 aa
MLETWSVCRRSDFHFRELGQCGSAPAGISTSMVRSVCIVGGTHGNERHGVHMVRHYQEHS
RLIERKTFTTSLLIANPMAVANKGTGAGTRYVDEDLNRCFLKQTLASAESATSVEGARAR
EINQILGPKASPEPACDFIFDLHNTTSNTGILLCYHPTDKLSYLMSEYLFSKNPHIRVCL
WPEGDRQVVVVPLSCAHLQQSSSTDRGQKWHDSGGSAVSHSTVHAKKLMETMEVKRGSCV
PVLSKRQLIQHGLDFIDMFNMRMEELGASADFSVTDVNISELGKVPIFTGAGKIDYPRDS
DGNIIGFIHPNLQGIAELQEGSTIQEGDDLFQAKHFISAPCSSLSPACQMLDGSVRPFVM
EVALKEAVGNAALYPLFVNEAAYYEQGSCCLPSLKHDTFTQGLQ
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgctcgagacttggagcgtgtgcaggagatctgactttcattttcgcgagcttggtcaa
tgcgggtctgccccggcaggaatatccacatccatggtgcgatcagtctgcatcgtggga
gggacgcacgggaacgagcggcatggcgttcacatggttcgccactaccaagaacactcg
cgcctaattgagaggaagaccttcacgacttctctgctcatcgccaaccccatggcggtg
gcgaacaaagggactggcgcaggaacccgatacgtggacgaggacttgaatcgatgcttc
ctgaagcagaccttggcttcagctgagagtgcgacaagtgtggagggagcgagagcaaga
gagatcaatcagattctggggcccaaagcatctcccgaaccagcttgtgacttcatcttc
gatcttcacaacaccacgtccaacaccgggatactgctctgttatcatcccaccgacaaa
ctctcttacctcatgtctgagtacttgttctccaagaatccccacatccgcgtttgtcta
tggccggagggagacaggcaggtcgttgtggttcctctctcgtgcgctcatctccagcag
agctcttctaccgaccgtggccagaagtggcatgacagtggaggtagcgccgtgtcgcat
agtactgtgcatgctaagaagctcatggagaccatggaggtgaagagaggatcttgtgtg
ccagtgctgagcaagcggcagctgattcaacatggtcttgacttcatcgacatgttcaac
atgcggatggaggagctaggagcctcggccgacttctccgtcacagatgtgaacatctcc
gagctgggcaaggtccccatcttcactggggcaggcaagatagactacccgagagacagc
gacggaaacatcatcggattcatccatcccaacctgcaaggcatagcagagctacaggag
ggcagcacgatacaagaaggagacgatctcttccaggcaaagcacttcatttcagccccc
tgctcctccttatcccctgcttgtcagatgctcgatggctccgtccggcccttcgtcatg
gaggtcgccctgaaggaggcggtcgggaacgcggcgctctacccgctcttcgtcaacgag
gccgcctactacgagcaaggcagctgctgcttgccctcgctcaagcatgatactttcacg
cagggactgcaatga

DBGET integrated database retrieval system