KEGG   Guillardia theta: GUITHDRAFT_131831Help
Entry
GUITHDRAFT_131831 CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
gtt  Guillardia theta
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gtt01001]
    GUITHDRAFT_131831
Enzymes [BR:gtt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     GUITHDRAFT_131831
Protein kinases [BR:gtt01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   GUITHDRAFT_131831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CaMKII_AD SnoaL_3 DUF4440 SnoaL_2
Motif
Other DBs
NCBI-GeneID: 17311430
NCBI-ProteinID: XP_005841814
JGI: Guith1_131831
UniProt: L1K2L8
Position
Unknown
AA seq 131 aa AA seqDB search
MSFGRAEEGVVKALQDILESAGNKDWEKYEKLCDKDITCFEPESVGNVAKGLAFHKYYFD
LPSGPSSGIKNNVTLADLNVRILGEGNSAVACYNRLIQKLEDGSPVTVKSHESRVFEMKQ
GKWVCVHFHRS
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttgggagggcagaggagggagtggtgaaggcgctccaagacattcttgagtct
gcagggaacaaagactgggagaagtatgagaagctctgcgacaaggacatcacttgcttc
gagcctgagagcgttggcaacgtagccaagggacttgcgttccacaagtactacttcgac
ttgccgtcaggtccgtcctcaggcatcaagaacaacgtcactctagctgacctcaacgtg
cgcatcctcggggaaggaaactcagctgtggcttgctacaacaggctgatccagaagctg
gaggacgggagcccagtgacggtgaagtcccacgaatccagagtgtttgagatgaagcaa
gggaagtgggtctgcgtgcatttccatcgctcgtga

DBGET integrated database retrieval system