KEGG   Guillardia theta: GUITHDRAFT_132677Help
Entry
GUITHDRAFT_132677 CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
gtt  Guillardia theta
Pathway
gtt00564  Glycerophospholipid metabolism
gtt00565  Ether lipid metabolism
gtt00590  Arachidonic acid metabolism
gtt00592  alpha-Linolenic acid metabolism
gtt01100  Metabolic pathways
gtt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GUITHDRAFT_132677
   00565 Ether lipid metabolism
    GUITHDRAFT_132677
   00590 Arachidonic acid metabolism
    GUITHDRAFT_132677
   00591 Linoleic acid metabolism
    GUITHDRAFT_132677
   00592 alpha-Linolenic acid metabolism
    GUITHDRAFT_132677
Enzymes [BR:gtt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     GUITHDRAFT_132677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 17310555
NCBI-ProteinID: XP_005840546
JGI: Guith1_132677
UniProt: L1JYA8
Position
Unknown
AA seq 1198 aa AA seqDB search
MPAKRDPGRPVWYHASTSPRSSQSLPTHAGSEGCFSADALEHLSAHSDVGCQELKSISSG
KDNSENYVLRSFDSSNVKSVLVEEWLATAQKSQESASNACDVERECVVVIDSYIESQRRS
PWLDWGEFPLLPVGDPPPKTPVLSRVEGIYPFAKLQQASKIFGGRLASDASFSRLSYGSF
CSNVDLEASKNQDVMAGENDQEQEREACFQDIDESKVQMNAETITPEDIKAAQEVVSKDT
NVQDNSIATLWMGLNSQLTEMMKPTDQLSDSREGKAEAEGQQLWGSALEVAKDVFSLFSL
SDSHPHGLHNTSSSAVSFRSLSLTEKECAWDLQVLAGAADGEWVIDSPRLSKGREEGRTL
EKGEKEQDKEGKGEKVEQEEGEGWFYSSNFPLGNDNIIRQPVSNVCGPYDYSRWRRWLRR
RVIRAMEKYHVSIQYKQGDPVGDMPEEAIPAGSLAVCNICTEMLHVGVYIPADNDTYLLR
AGEVVCLEMAAFCKVKSVKGEKALIVASRRSSYLPPIITKENLQRLCVMDPLKYVKKIFI
AAMPGQYATDYTTIRSIAHVIGFDGVYAMNKIFTLGCLLAASELGILDCCIYSASLSGSA
WLQVENILAMCDISQIEFWQACWMNMKGSCAESLKSLRQWLGLCLQRHPILQAALAEGGQ
DAVLMERDVKLEFDVQTRKEYMKLRAKLLTSASSFGGSENQPPIAAGAGEEEAMEEDENG
GTILLSNLGIETFKMDSSSLFWSDEHVRGVAQLFGDASLHVNNSIMQAQSTIHSLKLRQE
SRDAFEEEVKQWTAWSSRLRGGKRSANSRMEGMRGVGDLSFVEMYGLLAANAWLPPCPKD
RLWRMERGLSSQIESLQLHDRPFPLYVAVGIDHKKVDGEESNEYHWYEFSPFSFSSSQTG
KRIPIWSLGRSFHSGRSCSVTPEFPLGVCMGIWGAAFTASTEEVKKNYRNTSSRAQSRRD
VVQIIHDTFNILDSNSSDQAIDEVSQVKTSSRAGSIRVVEPFQCFNPFFEDPSHLEEDPC
TGCPPSKPSSSFTHPHHLTAADAETSDLRLTDAGIHMNAPLPALLRRERASDVIILLDSR
STSGEADVNDSFDVLKPAEEYAKQRDLPFPSIRDQDLIEIGRRRCTVLGFEEDSAPEIVY
MPLVKNEEVDEDLDPLHTPWCDFMEFAYEPEHFERLFQETRSGPGTRPVAEACRIESS
NT seq 3597 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaaaacgagatcccggtagacctgtttggtaccatgcttcaacaagtccgagg
tccagccagtctttgcctacacatgctggcagtgaaggctgcttcagtgccgatgcgctg
gaacatctctcggcacacagtgacgttgggtgtcaggaattgaaaagcatttcatcaggc
aaggacaacagcgagaattatgtacttcgaagctttgattccagcaatgttaagagcgta
ttggtagaagaatggctcgctactgctcagaagtctcaggaaagtgcttccaacgcttgt
gatgttgagagggaatgtgtcgtggtgatcgatagctacattgagtctcaaagaaggtct
ccttggcttgactggggagagtttccgctgcttcctgtgggagaccctcctcccaagact
ccagttctgagtagagtggaaggaatctatccttttgccaagctgcagcaagcgagcaag
atctttggggggagactcgcgtcggatgcgtcgttttcgaggctatcttacggttccttc
tgctcgaatgtggaccttgaggcgagcaagaaccaagatgtaatggccggagaaaatgac
caagaacaagagagagaagcatgtttccaagatattgatgagtctaaggttcaaatgaac
gccgaaacaatcacgcctgaagacatcaaggcagctcaagaagtagtgagcaaagacacg
aacgttcaggacaacagtatagctaccttgtggatggggttgaactcacaactgacggag
atgatgaagccaacggatcagctttcggattctagggagggcaaggcggaggctgaaggg
cagcaactgtggggcagtgctctcgaggtcgcaaaagacgtgttctctctcttttctctg
agcgacagccatcctcatggcctccataataccagcagttcagccgtctcctttcgctcc
ctctccctcactgagaaggagtgcgcttgggacctccaggtacttgcaggagcagccgac
ggagagtgggtgatcgacagtccgaggctctcaaagggaagggaggagggaagaacattg
gaaaagggagagaaggaacaagacaaggaggggaaaggggaaaaggttgagcaggaagag
ggggagggctggttctactcgagcaactttcctctagggaatgacaacataatccgtcag
ccggtgagcaacgtgtgcggaccgtatgactattcgagatggaggaggtggctgaggcgg
agggtgatacgtgcgatggagaagtatcatgtcagcatccagtacaagcagggagatcca
gtgggtgacatgccagaggaagcgatacccgcgggctcccttgcagtctgcaatatttgc
accgagatgctgcatgttggggtgtacatccctgcagacaatgacacgtacctcctccga
gccggagaggtcgtctgccttgagatggcagcgttctgcaaagtgaagagtgtgaaagga
gaaaaggctttgattgttgcatcgaggaggagcagttacctccctccaatcatcaccaaa
gagaacctgcaacgtctttgcgtcatggatcctctcaagtatgttaagaagattttcatc
gcagcaatgccaggccaatacgcgaccgattacacgacaataaggtcaattgcgcacgtt
attggatttgatggagtgtatgccatgaacaagattttcacgctgggatgtttgctggct
gcaagtgaacttggtattcttgactgctgtatttattcagcaagtttatctggatcagca
tggctacaggtcgagaacatcttggctatgtgcgacatctcacaaatcgagttttggcag
gcttgctggatgaatatgaaggggtcatgtgcagaatccttgaagtctctgcgacaatgg
ctgggcctctgcctccagcggcatcctatcttgcaagcagcgctggcggagggagggcag
gacgcagttttgatggaaagagatgtaaagcttgagtttgatgtacagacgaggaaagaa
tatatgaagctcagagcaaagttgttaacatcggccagttctttcggagggagcgagaat
cagcctccgatagctgctggtgcaggtgaggaggaggcgatggaggaagacgagaacgga
ggaaccatcctgctgtcgaatcttgggatagaaacgttcaaaatggattcatcaagcttg
ttttggagtgacgagcatgtacggggagtagctcagctgtttggagacgcgagtttacat
gtgaacaattccatcatgcaagcccaaagcaccattcactctctcaagttgcggcaggaa
tcgcgagatgcgtttgaggaggaggtgaagcagtggacggcctggtcttcgaggctgagg
ggagggaagcgaagtgcgaactcgaggatggaagggatgaggggggtgggcgatctttct
ttcgtcgagatgtatggcctacttgctgccaacgcttggctgcccccttgcccgaaagac
aggctatggaggatggaacgaggcctttccagtcagatcgaaagtctacaacttcatgac
aggccatttcccctctatgtagccgttggcatcgaccataagaaggttgacggggaggag
agcaatgagtatcattggtatgaattttctcctttctccttctcgtctagtcagactggc
aaaagaattccgatttggtcgcttggaagaagttttcactcaggcagaagttgttctgtc
actcccgagtttcctctaggagtgtgcatgggcatatggggagctgctttcacagccagc
acagaggaggtgaagaagaattatcggaatacgtcttcgagagcacaaagtcggagggat
gttgtacaaatcatacacgacaccttcaacatcttggattcaaactcgtccgaccaggca
atcgacgaggtgtcgcaagtcaagacaagttctcgggcaggatcgatcagggttgtggag
cccttccagtgcttcaatcctttcttcgaagatccatcacaccttgaggaggatccttgc
accggttgtcctcccagcaagccttccagctccttcacgcatcctcaccacttgaccgct
gcagatgccgagacgtcggacctccgcctgacagatgctggaattcacatgaacgctcct
ctccctgctcttctgcgcagggagcgtgcgagtgacgtcataatcctgctggactcccgc
tcgacgtcaggagaagctgatgtgaacgattcgtttgacgtcttgaagcccgcggaggaa
tatgcgaaacagagggacttgccgtttccttccatccgagatcaagatctcatcgagatc
gggaggaggagatgcacagtgctaggctttgaggaggacagcgctccagagatcgtttac
atgccactcgtgaagaacgaagaagtcgatgaagatctggatcctctacatacaccatgg
tgtgacttcatggaatttgcgtatgagcctgaacacttcgagagactgttccaggaaacg
cgcagcggccctggcacgcggccggtcgccgaggcttgtcgaatcgagagctcataa

DBGET integrated database retrieval system