KEGG   Guillardia theta: GUITHDRAFT_140223
Entry
GUITHDRAFT_140223 CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
gtt  Guillardia theta
Pathway
gtt00230  Purine metabolism
gtt00240  Pyrimidine metabolism
gtt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GUITHDRAFT_140223
   00240 Pyrimidine metabolism
    GUITHDRAFT_140223
Enzymes [BR:gtt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     GUITHDRAFT_140223
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_17 AAA_21
Other DBs
NCBI-GeneID: 17300510
NCBI-ProteinID: XP_005830756
JGI: Guith1_140223
UniProt: L1J5L1
Position
Unknown
AA seq 254 aa
MAGKSTFLRVLQSRFPVSTVQEPVDKWQKISRFAIGISFLELTISSNEGEKSDNLLDMFY
KDPKRWAYTFQTYAFLSRLETQLSKDSSPSKIVILERSVASDKEIFGLFNGVEVEWRTSR
LSDGLTSEQWALYSEWHEWMMKRFHPDSEVDAYVYLRTRPETCMRRLHKRGRGEEKSIPL
DYLQQIHERHEEWLMQGAAGGKMGDRLLTRRSRGDEKPVLVVDCEQEDDGRSAREEELVG
QVREFLDRCFPGHL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggcaggaaagagcacgttcctcagagttctgcagagtcgttttccagtgtccactgta
caggaaccagttgacaagtggcagaaaatatcgaggtttgccattgggatttcattcttg
gagctgaccatcagcagcaacgagggagaaaagtcagacaacctgctggatatgttctac
aaagatccgaaacgatgggcgtacacctttcagacttacgccttcttgagccgactggaa
acacagcttagcaaagattcgtctccgtcaaagatcgtcatcctcgagcgatcagtggcg
tcagacaaggagatcttcggcctgttcaatggcgtcgaggtagagtggcggacgtccaga
ctgtctgacggtctgacgagcgagcagtgggccctttacagtgagtggcatgagtggatg
atgaagagatttcatcctgacagcgaggtcgacgcctacgtctacctccgcacaaggcca
gaaacatgcatgagaaggctgcacaagaggggcaggggagaggagaagtccatcccccta
gactatctgcagcaaatccacgagagacacgaagagtggctaatgcagggagcagcgggc
gggaagatgggagaccggctactgacgagacgctcccggggggatgagaaacctgttctt
gtggtggactgcgagcaagaggacgacgggagatcagcaagagaggaggagcttgttggg
caggttagagagtttctagaccggtgctttcccggtcatctatag

DBGET integrated database retrieval system