KEGG   Guillardia theta: GUITHDRAFT_159505Help
Entry
GUITHDRAFT_159505 CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K21682  pyruvate dehydrogenase (NADP+) / aquacobalamin reductase (NADPH) [EC:1.2.1.51 1.16.1.5]
Organism
gtt  Guillardia theta
Pathway
gtt00860  Porphyrin and chlorophyll metabolism
gtt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GUITHDRAFT_159505
Enzymes [BR:gtt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.51  pyruvate dehydrogenase (NADP+)
     GUITHDRAFT_159505
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.5  aquacobalamin reductase (NADPH)
     GUITHDRAFT_159505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: POR_N FAD_binding_1 Flavodoxin_1 POR EKR NAD_binding_1 PFOR_II Fer4_6 Fer4_21 Fer4 Fer4_7 Fer4_9 Fer4_10 Fer4_16 Fer4_8 Fer4_2 Fer4_17 Fer4_18 IDEAL Fer4_3 Fer4_4
Motif
Other DBs
NCBI-GeneID: 17304961
NCBI-ProteinID: XP_005835303
JGI: Guith1_159505
UniProt: L1JII2
Position
Unknown
AA seq 1776 aa AA seqDB search
MIKNTTWSCIDGNQAAAHIAYALSEVSFIYPITPSSPMGEMVDEWAANGLKNIFGQTLSV
TEMQSEAGAAGALHGSLKAGTFASTYTASQGLLLMIPNMYKIAGELLPCVMHVSARTLCA
HALNIFGDHSDVMAARTTGWVMLASENPQMVMDQALVSHLATMDMRVPVLHFFDGFRTSH
EVNKVRVINYDDIKKIFPWDSVKTHHDSALSPMNPHIQGTNQGPDVFFQAAEAANAIHNT
IPAYMQKWSEKVAEITGRRYGFFSYEGHPEAENVIVIMGSGAVTVHETVKYLNSHQNQKV
GVLKVRLFRPWITERFMAALPASVKRIAVLDRVKEVGAIGEPLFCDVCTTLHLSGMDHIK
VYGGRYGLGGKDFTPGMVLSVFKNLEAAHPKTKFTVGIVDDVTNLSLNVEQEVDMLPSGT
IQCLIYGLGSDGTVGANKSAIKTIAQNTDNFAQGYFEYDSKKSGGLTVSHLRFGPHPINA
PYLVKNADYIGIHKESYLSRLDMLRNLKENGTVVINCTFGPEKVENMLPPRMKYQLASKK
ASLYLINAVKVGRETGMGKRINMVMQSVFFKLSRVLPFEKAIELLKKDVQKMYGKKGEEV
VKRNWDAIDRSIENLVEVPVPAQWAQIPVTTNKEIRKSTLEFVDEIVEPVNKFEGNDLPV
SAFVPGGRVPTGTSAFEKRGIALQVPRVDMDKCTQCNYCSLICPHAAVRPFLFTKAELEG
APEGIKKGSRKAIGGGVLDNYNFRVQVSPLDCTGCELCVRICPADALFFEETDKAVELEA
ENWNYAISVPNKGEEIDKTTVKGSQFQQPLLEFSGACEGCGETPYVKLLTQLLGDRLVVA
NATGCSSIWGASAPSFPYTVNARGEGPAWANSLFEDNAEFGLGMRRAFKQRRNQLMFLVD
DALEDKTVPLSDKLRKLLSQYSVMRHEDKLDMLLPKGRSFYNQLREKIIPLLREEAKNHE
KIQELWDQADIFGRHSHWIIGGDGWAYDIGFGGLDHVLASEEHINVLVLDTEMYSNTGGQ
ASKSTPRGAQAKFAETGKLTAKKDLGQYAMTYKNVYVASICIHVNHQQAIRALLEAEAYP
GPSLVICYSPCISQGFPMAEAIQQCRDAVESGYWPLYRYNPLLAEGGNNPFQLDSKKISG
DLFTFLAHENRFASVMRRNPSYAQAHQDRLQRQIADRAKALNVLSLDELPASLKAAGPSE
SVTVLYGSETGNAEEQAKSLFADLKARGTSATLSSLDDFDFEELPNQSTVLVVISTCGQG
EFPANSHKFWMKLSDPTLPMSFLEGIKFSVFGLGDSTYSLFCVAAERIDVRLAELGATRI
LNRGIGDDRDEDRYYTGWDNWTPQLWNALHVPQKPLERKIPKPAYKVTRTQGEATPSVSN
DKLVPPGSNPLKLMENTLLTPEGYDRDIRHYVFKIKDTNVEYKVGDVLAIYPRNHVDQVE
EFCKMYGLDPNEELNVVSTPEARNQIPEELNVRQLLQCVLDIFGKPNRRFYDTLSLFATD
PAEKQKLELITSEDPDGKALYRELSHDMANHADVLKRFPSARPPLEQLMDMIPVIKPRSY
SIASAPSMHPDEIELCIVAVDWEVPSTGEKRFGQCTSYLRTTKPGDTIMCSVKPSSIVLP
EDNKAPLLMAGMGTGLAPWRALTQHRIALKQQGIDVGPCTIYYGARKGATEYLYREEFEK
YEKMGVLRMVTAFSRDQPQKIYVQHRIREDYENVFRQLMKEQGSFYVCGSSRNVPEDIYN
AMKEVMMLGGGMQEADAEAALASLKMDGRYTVEAWS
NT seq 5331 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaacacaacctggtcttgtattgatggaaatcaggcagcagcgcatattgca
tatgctttgagtgaggtttccttcatttatcccataactccatcatcacccatgggtgag
atggtggatgagtgggcagcaaacggattgaagaacatcttcggccaaactttgagcgtc
actgaaatgcagagtgaagccggcgcagctggtgctctacatggcagcttgaaggctggt
acgtttgcctctacatatacggcttctcaagggttgctccttatgataccgaatatgtat
aagattgctggcgagctcctcccgtgtgttatgcatgtatctgctaggactttgtgtgct
cacgcattgaacatctttggtgaccacagcgatgttatggccgcacgaacaacgggatgg
gtcatgctcgcatccgaaaatcctcagatggttatggaccaggcacttgtgtcacacctt
gcgaccatggacatgcgtgtcccggttctacacttctttgatggtttccgtacttcacac
gaagttaacaaggtgcgagtcatcaactacgacgatattaagaaaatttttccatgggat
tctgtaaaaactcaccatgactcagctctttcacctatgaatcctcacatccaaggcaca
aaccagggtccagatgtgttctttcaggctgctgaggctgcaaatgcaattcacaatacc
attccagcatatatgcaaaagtggtccgagaaagtggcagagattactggaagacgatat
ggattcttttcctatgaaggtcatcctgaagcagagaacgttattgtaattatgggcagt
ggagcagtaacagttcacgaaactgtgaagtaccttaattcacaccagaaccagaaagtg
ggtgtcctgaaggtgcgactgttccgtccatggatcacagaaagatttatggcagctctt
ccagcatcggttaagagaattgctgtgttggatagggttaaagaagtgggcgctattgga
gagcccttgttctgtgatgtatgtaccactttgcatctgtcaggaatggaccacatcaag
gtttacggaggaaggtacggtcttggaggaaaggattttaccccaggaatggtcctttcc
gtgttcaaaaatttggaagctgcacaccccaagaccaagttcacggtcggcattgttgat
gatgtaacgaacctttccttgaacgttgaacaagaagtcgacatgctaccttcagggacg
attcagtgcttgatctatggattgggctcggacggtaccgttggtgcaaacaagtcggcc
atcaaaacaattgcgcagaacactgacaactttgcacaaggctacttcgaatatgactcg
aagaagtctggagggttgacagtgtcccatcttcgtttcggaccccatccgatcaatgct
ccataccttgtgaaaaacgctgattacattggaatccacaaggaaagctatctttcaagg
ctcgacatgctccgaaacctgaaggaaaatggaacggttgtgatcaattgcaccttcggt
ccagagaaagtagagaatatgcttccacctcgtatgaaataccagcttgcctcgaagaag
gcttctttgtacttgatcaatgctgtcaaggttggcagggaaacgggaatgggaaaacga
atcaacatggtcatgcaatccgttttcttcaagctcagtcgtgtgctgccgtttgagaaa
gctatcgagttattgaagaaggatgttcaaaaaatgtatggaaagaagggtgaagaagtc
gtcaagcgcaattgggatgccatcgatcgttctattgaaaatttggttgaagttccagtg
cctgctcaatgggcccagattccggttactacgaacaaagaaatcagaaaatctaccctt
gaattcgttgatgaaattgttgaacctgtcaacaaatttgagggcaacgacttgcctgta
agtgcgtttgtcccaggtggtcgtgtacccactggaacatcagcattcgagaagagagga
attgctctccaagtgcctcgtgtagatatggacaaatgcactcagtgcaattactgctcc
cttatctgccctcacgctgccgtgagaccattcctgttcacaaaggccgagctcgaaggc
gcccctgaaggcatcaagaaagggtccagaaaggctattggcggtggagttctagacaac
tacaactttcgcgttcaggtgtctccacttgactgcacaggatgcgaattatgtgtccgc
atttgtcctgctgatgctttgttcttcgaggaaaccgataaggctgttgagttggaagct
gagaactggaactatgccatttcagtgccaaacaagggagaggaaattgacaagaccacc
gttaagggttcacagtttcagcagcctttgttggaattcagcggagcttgtgaaggatgc
ggtgaaactccttatgtgaagctgttgactcagcttttgggagaccgtttggtcgttgca
aatgcaacgggatgctcttcaatttggggtgcctctgctccatcattcccttacactgtc
aatgcacgtggtgaaggacctgcctgggcgaattctctctttgaggataatgctgagttt
ggacttggaatgcgtcgtgcatttaagcaaaggagaaatcagctcatgttcttggttgac
gatgctttggaggataaaactgtgccgctcagtgacaaacttcgcaaacttctctcccaa
tattccgttatgcgacatgaagataagcttgacatgcttttgcccaaaggaagatcgttt
tacaatcagctgcgggagaagattattccacttctgagagaggaagctaaaaaccatgaa
aagattcaggaattgtgggatcaggcggatatatttggaaggcacagtcactggattatt
ggtggtgatggatgggcgtacgatattggatttggaggtttagatcatgtcttggctagt
gaggagcatatcaatgttctggtcttggataccgaaatgtattccaacactggaggtcaa
gcttcgaagtctactccacgtggtgctcaagccaagtttgcagaaactggaaaattgaca
gccaagaaggaccttgggcagtacgctatgacttacaagaacgtctatgttgcatctatt
tgtatccatgtcaaccatcaacaagccatccgagcacttctggaggctgaagcatatccc
ggaccttcgcttgtgatttgctattccccatgtatttcacagggcttcccaatggctgag
gccattcaacaatgtcgcgatgcagtcgagagtggatattggcctttgtatcgttacaat
cctcttctcgcagagggtggaaacaatcccttccagttggatagcaagaaaatctctggc
gacttgttcactttcttggctcacgaaaatcgctttgcatcagttatgaggagaaatcct
tcctatgcccaagcgcatcaagaccgcttacaacgacagattgcagacagagcgaaggct
ctgaatgttttgagtcttgatgaacttccggcatctctcaaggctgctggtccatccgag
agtgtgactgtgctttacggctctgagactggaaatgccgaggagcaagccaaatcactt
tttgccgatttgaaagcaagaggcacctcagcaaccctatctagcttggatgactttgat
tttgaggaacttccaaatcaaagcacggttttggttgtcatttcaacgtgtggtcaaggc
gaatttccggcaaattctcacaaattctggatgaagctctctgatcccacactgccaatg
tcatttttggaaggaatcaagtttagcgtgtttggtcttggtgattccacgtactccttg
ttttgtgtcgctgccgaaagaattgatgtgaggctggctgagctgggtgccactagaatt
ttgaatcgtggaattggtgatgacagagacgaggacaggtattacacgggctgggataac
tggacaccgcaactttggaatgctttgcacgtcccacagaaaccattggagcgaaagata
cccaaacctgcgtacaaggtcactcgtacccagggagaagctaccccatcagtttcgaat
gataagcttgttcctccgggatcaaatccattgaagctgatggaaaacacgttgctcacg
ccggagggttatgaccgtgacatccgacactatgtgtttaaaatcaaggatacgaatgtt
gaatacaaggttggtgatgtacttgcaatctatccaagaaaccacgtggatcaagttgag
gagttctgcaagatgtatggtttggatcccaacgaagagctcaatgtcgtttctactccc
gaggcaagaaatcagattcctgaagagctcaatgttcgtcagcttcttcagtgcgtgctt
gatatcttcggcaagcccaacaggcgcttctacgatactttgtctctcttcgccacagac
ccggctgagaagcagaagcttgagcttatcacttctgaagacccagacggcaaggccttg
tacagagaactttcacatgacatggcaaatcatgctgatgtcttgaagcgtttcccttca
gcaaggcctcctctggagcagcttatggacatgattccggtgatcaaaccgcgttcctac
tccatcgcttcagctccaagtatgcaccctgatgagattgagctttgcatcgttgctgtc
gactgggaggtgccttcaacgggcgagaagagattcgggcaatgcacaagctacctgcga
accaccaagcctggagacaccatcatgtgctctgtgaaaccaagttccatcgtcctccct
gaggacaacaaggctcctctccttatggcaggcatgggcaccggtctggcgccatggcgt
gccttgacccagcatcgcatcgccctcaagcagcaaggcatcgatgttggaccctgcacc
atctactacggcgcacgcaagggtgcaaccgagtacctctaccgcgaggagttcgagaag
tacgagaagatgggagtcctaagaatggtcacagccttctcgcgcgaccagccgcaaaag
atttatgtgcaacatcgcatcagagaagactacgagaatgtgttccgacagctgatgaag
gagcagggcagtttctatgtgtgcggatcttctcgaaacgttcccgaagatatctacaac
gcaatgaaggaggtcatgatgcttggtggagggatgcaggaggctgatgctgaagccgct
cttgcttctctcaagatggacggacgttacacagtcgaggcttggtcgtag

DBGET integrated database retrieval system