KEGG   Guillardia theta: GUITHDRAFT_57327
Entry
GUITHDRAFT_57327  CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
gtt  Guillardia theta
Pathway
gtt00230  Purine metabolism
gtt00240  Pyrimidine metabolism
gtt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GUITHDRAFT_57327
   00240 Pyrimidine metabolism
    GUITHDRAFT_57327
Enzymes [BR:gtt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     GUITHDRAFT_57327
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 AAA_17 DUF1706
Other DBs
NCBI-GeneID: 17291801
NCBI-ProteinID: XP_005822057
JGI: Guith1_57327
UniProt: L1IG60
Position
Unknown
AA seq 201 aa
AGQSRFFSFEGIIGAGKSTLLRKLQENGVVVIPEPLQAWQDNGIFEAFYKDMSRWSFTFQ
IAAFTTRVKSVEEAISSTSSSSSPWMVGERSWFADSYVFEPLLHRDGHLNNMEHDSYKLW
WQWAEQRAPRTSGIIYLRASPRTCLKRIQKRSRAEEADIPLGYLEGLFEKHEDWLMHRKT
PYGRHDIPVLVLNADVEFESN
NT seq 603 nt   +upstreamnt  +downstreamnt
gccggacagagcaggttcttctccttcgaaggcatcataggggcaggcaagagtactcta
ttgcggaagcttcaagagaacggggtagttgtgatacctgagcctctccaagcgtggcag
gacaacggaatctttgaggccttctacaaggacatgtcgagatggagcttcaccttccag
attgctgcgttcacgacacgtgtgaagtcggttgaggaggccatctcctcgacctcctcg
tcctcctcgccttggatggtgggagagcgatcatggtttgcagactcgtatgtcttcgag
ccgctcctgcacagggacggacatctcaacaacatggagcacgacagctacaagctgtgg
tggcagtgggcagagcaacgagccccccggacctcgggtatcatataccttcgagcatca
ccgcgcacgtgccttaagagaatccagaagcgttcaagggccgaggaggcggacattcca
ctggggtacctggaggggctctttgagaagcacgaagactggctcatgcacaggaagacg
ccgtacgggaggcacgacattccagtcctcgtgttgaatgccgacgtcgagttcgagtcc
aac

DBGET integrated database retrieval system