KEGG   Guillardia theta: GUITHDRAFT_73807Help
Entry
GUITHDRAFT_73807  CDS       T02925                                 

Definition
(RefSeq) heat shock protein 70-like protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
gtt  Guillardia theta
Pathway
gtt03040  Spliceosome
gtt04141  Protein processing in endoplasmic reticulum
gtt04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    GUITHDRAFT_73807
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    GUITHDRAFT_73807
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    GUITHDRAFT_73807
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gtt01009]
    GUITHDRAFT_73807
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gtt03041]
    GUITHDRAFT_73807
   03009 Ribosome biogenesis [BR:gtt03009]
    GUITHDRAFT_73807
   03110 Chaperones and folding catalysts [BR:gtt03110]
    GUITHDRAFT_73807
   04131 Membrane trafficking [BR:gtt04131]
    GUITHDRAFT_73807
   03051 Proteasome [BR:gtt03051]
    GUITHDRAFT_73807
   03029 Mitochondrial biogenesis [BR:gtt03029]
    GUITHDRAFT_73807
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gtt04147]
    GUITHDRAFT_73807
Protein phosphatases and associated proteins [BR:gtt01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     GUITHDRAFT_73807
Spliceosome [BR:gtt03041]
 Complex B
  Other components
   Prp19 complex
    GUITHDRAFT_73807
 Complex C
   Prp19-CDC5 complex
    GUITHDRAFT_73807
Ribosome biogenesis [BR:gtt03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    GUITHDRAFT_73807
Chaperones and folding catalysts [BR:gtt03110]
 Heat shock proteins
  HSP70 / DNAK
   GUITHDRAFT_73807
Membrane trafficking [BR:gtt04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    GUITHDRAFT_73807
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    GUITHDRAFT_73807
Proteasome [BR:gtt03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    GUITHDRAFT_73807
Mitochondrial biogenesis [BR:gtt03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    GUITHDRAFT_73807
Exosome [BR:gtt04147]
 Exosomal proteins
  Proteins found in most exosomes
   GUITHDRAFT_73807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl PilM_2 DUF1464
Motif
Other DBs
NCBI-GeneID: 17299094
NCBI-ProteinID: XP_005829545
JGI: Guith1_73807
UniProt: L1J391
Position
Unknown
AA seq 384 aa AA seqDB search
YSRVAIVKNDKPEVIANAQGAHSTPSVVAFNENETLVGEVAYNFGTKNPTNTVFDAKRFL
GRNQDDEVLSSEGKRWRFNVMYKEQKPVFQVPYNGSPTNFTPEQICGQIFANLKSTAEAY
MHTNIRNAVLCCPAHFTSQQREELIHSACDANLSVLLVISKPIATAIAYDLDKNDSGQQT
ILIFSMGARSCEVVVLDVNTGCFQERSVKVDHSLGGDAIDDILVDWFVDQFKRKHKLDPS
ESHRSLFKIRSGCENAKRQLSQTASTRVEVESAHEGLDFSQNLSRAKFEEMVSVISAVVQ
LLRSVYSAGSINKVLMAGGCSRIPKVQSIVQQSLPDVEVCLNILPDEAGVLGTAIQGSTL
VGSSWSTAEANSSNIEISALPRVC
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
tattcgagagttgcgattgtgaagaatgataaaccagaggtcatcgcaaatgctcaaggc
gctcattctactccgtctgttgtagcctttaatgagaacgagacattagtgggtgaagta
gcgtacaattttggaacgaagaatcctacaaatactgtcttcgatgccaagaggtttctg
ggacgaaatcaggatgatgaggttttgtcgtcagaggggaagcgatggcgtttcaatgtc
atgtacaaagagcagaagccagttttccaggtgccgtacaacggatcccccacaaacttc
accccagagcagatttgtggtcaaatctttgcgaacctgaagtctacagcagaagcgtac
atgcataccaacatcaggaatgcagtgctttgctgtccagctcatttcacgtcacaacaa
agggaggagttgatacattctgcatgtgacgccaacctctcagtcctgttggtaattagc
aaacctatcgcaactgctatcgcatacgatctcgataaaaatgactcgggtcagcaaaca
atcctaattttcagtatgggtgcaagatcgtgtgaagtggtggttcttgatgtaaatacg
ggatgctttcaagagcggagtgtgaaagtagatcattctcttggaggcgacgcgatcgac
gacatacttgtggactggtttgtcgatcaattcaagaggaagcacaagctcgatccatcc
gagagccatagatcactcttcaagattagatcgggatgtgaaaatgcaaagcgacaactt
agtcagacggccagcactcgcgtagaggtcgagtctgcgcatgaaggtctagacttctct
cagaacttgtcaagggcaaagtttgaagaaatggtaagcgtcatatctgctgttgttcaa
cttctcaggtctgtgtacagcgcaggaagcataaacaaagtcttgatggctggtggctgc
tctcgtattccaaaggttcagtcgatcgttcagcaatccttgcctgacgtggaggtctgt
ctcaacattttgcctgacgaggctggtgtgctgggaactgcaatccaaggaagcactctg
gtgggctcgtcctggagtactgctgaagccaactcatcgaacatcgagatttcagccttg
ccaagggtctgctga

DBGET integrated database retrieval system