KEGG   Guillardia theta: GUITHDRAFT_74618Help
Entry
GUITHDRAFT_74618  CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K16944  septin 7
Organism
gtt  Guillardia theta
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gtt04131]
    GUITHDRAFT_74618
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gtt04812]
    GUITHDRAFT_74618
   04147 Exosome [BR:gtt04147]
    GUITHDRAFT_74618
Membrane trafficking [BR:gtt04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    GUITHDRAFT_74618
Cytoskeleton proteins [BR:gtt04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     GUITHDRAFT_74618
Exosome [BR:gtt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GUITHDRAFT_74618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 AAA_16 RsgA_GTPase Ras Roc AAA_7 AAA_22 NB-ARC AAA_24 PduV-EutP AAA_29 ABC_tran AAA_35
Motif
Other DBs
NCBI-GeneID: 17298243
NCBI-ProteinID: XP_005828569
JGI: Guith1_74618
UniProt: L1J0B7
Position
Unknown
AA seq 190 aa AA seqDB search
LKSGLLRQCEKELEQKGKTLTVMCVGESGVGKTSLISNILTVPISKAPPPPTKHITDNEI
RIKCDGIPLTATFIDTPGYGDIMQLEKSFYCIGTSHMYIDRRLEKAFRKENRRVRPDKLD
RSSGVGVDAVLYFIAPHRLKKIDLNFLKIIQGRASIIPILAKADTMTEAELKTFRALVVK
QLADVGFTSS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ctgaagtccgggctcttgcggcaatgcgagaaggagctggagcagaaggggaagacgctg
acggtgatgtgcgtgggggagagcggcgtgggcaagacctccttgatatcaaacatcttg
acggtcccaatctcaaaagccccacctcctccaacaaaacacatcaccgacaacgagatc
cgaatcaagtgcgatgggatccctttgaccgccacattcattgacacccctgggtacggc
gacatcatgcagctcgagaagagtttctactgcatcggtacatcgcacatgtacattgac
cgtcgtctcgagaaggcgttccgcaaggagaaccgtagggtcagacctgacaagttggat
cgctcgtctggggtcggagttgatgcagttctctacttcattgccccccaccgtttgaag
aaaatcgacctcaacttcctcaagatcatccaagggagagcaagcatcattcctattctc
gccaaggcagacacgatgactgaggctgagctcaaaaccttcagggcactcgtcgtcaag
caacttgctgacgttggttttacttcatcatga

DBGET integrated database retrieval system