KEGG   Guillardia theta: GUITHDRAFT_91782Help
Entry
GUITHDRAFT_91782  CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gtt  Guillardia theta
Pathway
gtt04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:gtt00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    GUITHDRAFT_91782
Enzymes [BR:gtt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GUITHDRAFT_91782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 17310885
NCBI-ProteinID: XP_005841089
JGI: Guith1_91782
UniProt: L1K0M1
Position
Unknown
AA seq 229 aa AA seqDB search
MFRQGNKLSTSISRLSTLASRAAGVRAKSTLPSLPYDFGALEPVVNSEIMTLHHGKHHAT
YVNNLNAALEKMSDAMAKQDYATMIALQGAIQFNGGGHLNHSIFWQNLCPVKDVVAPSEA
NPELAKAIEGQWGSLDNFKTEFNTKTAAIQGSGWGWLGYNKQSKKLEIATCANQDPLVMK
GLVPLLGIDVWEHAYYLQYKNARPEYLKQIWQVVNWKDVAARYEAAKKA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggcaaggaaacaaactcagcacaagcatctcccgcttgtcgactctcgcttcg
cgagcagcaggcgtcagggccaagtcaaccctcccatctttgccatacgatttcggtgcc
ctcgagccagtcgtcaactctgagatcatgacgctgcaccatggaaagcaccatgctaca
tacgtcaacaacctcaacgccgccttggagaaaatgtcggatgccatggccaagcaggac
tatgctaccatgattgcgttgcaaggagccatccagttcaatggaggtggtcacctcaac
cactccatcttctggcagaacttgtgtccggtcaaggacgtcgtcgctccctctgaggcc
aatcccgagttggcaaaggccatcgagggccagtggggctccctcgacaactttaagaca
gagttcaataccaagacagcggccattcaaggatccggctggggttggctgggatacaac
aagcagtccaagaagctcgagatcgccacgtgcgcgaaccaggaccctctggtcatgaag
ggactggttcccctcctcggtatcgacgtgtgggagcacgcgtattacttgcagtacaag
aacgcaagacctgagtacttgaagcagatctggcaggtggtgaactggaaggatgtagct
gcccgctatgaagcggccaagaaggcttag

DBGET integrated database retrieval system