KEGG   Geobacter uraniireducens: Gura_0219Help
Entry
Gura_0219         CDS       T00521                                 

Definition
(GenBank) recA protein
  KO
K03553  recombination protein RecA
Organism
gur  Geobacter uraniireducens
Pathway
gur03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:gur00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Gura_0219
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gur03400]
    Gura_0219
DNA repair and recombination proteins [BR:gur03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Gura_0219
    RecFOR pathway proteins
     Gura_0219
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Gura_0219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecA Rad51 ATPase ATPase_2 AAA_24 AAA_25 AAA CobU AAA_35 AAA_22 AAA_16 ABC_tran DnaB_C
Motif
Other DBs
NCBI-ProteinID: ABQ24435
UniProt: A5GDB6
Position
282254..283255
Genome map
AA seq 333 aa AA seqDB search
MQEREKAIDLALSQIEKQFGKGSIMRLGNDEPLPDVAAIPTGSLSLDMALGVGGVPRGRI
IEIYGPESSGKTTLALHIVAEAQKLDGIAAFIDAEHALDIGYARKLGVRTDDLLVSQPDT
GEQALEIAETLVRSGAIDVLVIDSVAALVPKAEIEGDMGDSHMGLQARLMSQALRKLTGI
ISKSNCCVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRMDIRKIASLKQGNDVIGSR
TKVKVVKNKVAPPFKEVEFDILYGEGISREGDILDLAVEKGVVDKSGAWFSYGKERIGQG
RENSRIYLKQNPEICAEIREKLTQAPVPAGGVA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaagagaaaaggcgattgacctggctttgagccagattgaaaagcagtttgga
aaaggctcaataatgcggctcggcaatgacgaaccgttgccggatgtcgcagccatccct
accggttcactttctctcgacatggctctcggcgtcggcggtgttcccaggggcaggatt
atcgagatttacggcccggaatcatcgggaaaaacgaccctggcgctccatattgttgcc
gaagcgcagaaattggacggcattgccgcattcattgacgctgagcatgccctggatatc
ggctacgcccgcaagctcggcgtaaggaccgacgacctgctggtttcccagccggatacg
ggcgaacaggccctggaaatagcggaaacgctggtgcgaagcggcgccatcgacgtgctg
gtcatagattcagtggctgcgctcgttcccaaggccgaaatcgaaggcgacatgggagat
tcgcacatggggctccaggcgcggctcatgtcacaggccctgcgcaagcttaccggcatt
atcagcaagtccaactgctgcgtcattttcatcaaccagatcaggatgaagatcggcgtc
atgttcggcaacccggaaaccaccaccggcggcaacgccttgaagttctatgcttcggtg
cgcatggacatccggaagatcgcgagcctcaaacagggaaatgacgtgatcggttcccgc
accaaggtgaaggtggtgaaaaacaaggtggcgcctcccttcaaggaagtggaattcgat
atcctttacggtgagggaatttcccgcgaaggggatattctcgatctggccgttgaaaaa
ggggtggtcgacaagagcggcgcctggttctcttacggcaaggaacggatcggccagggg
cgtgaaaattcgcgcatctatctgaaacagaacccggaaatctgcgcggagataagggag
aagctgacccaggcgccggtcccggctggaggcgttgcttaa

DBGET integrated database retrieval system