KEGG   Geobacter uraniireducens: Gura_0480Help
Entry
Gura_0480         CDS       T00521                                 

Definition
(GenBank) CO dehydrogenase/acetyl-CoA synthase gamma subunit (corrinoid Fe-S protein)-like protein
  KO
K00197  acetyl-CoA decarbonylase/synthase, CODH/ACS complex subunit gamma [EC:2.1.1.245]
Organism
gur  Geobacter uraniireducens
Pathway
gur00680  Methane metabolism
gur01100  Metabolic pathways
gur01120  Microbial metabolism in diverse environments
gur01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gur00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Gura_0480
Enzymes [BR:gur01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.245  5-methyltetrahydrosarcinapterin:corrinoid/iron-sulfur protein Co-methyltransferase
     Gura_0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CdhD
Motif
Other DBs
NCBI-ProteinID: ABQ24695
UniProt: A5GCK4
Position
550973..551929
Genome map
AA seq 318 aa AA seqDB search
MASELAWTDRLGGWKARWGIGRMSYLIPAGLYAVGQPTPADPVVVTANYKMSYDLVRRSL
AGRNVWLLVLETFGINVWCAAGKGTFGTDELVRRIGATGLAQVVTHRRLLLPILGAPGVA
AHEVAGLTGFTVRYATIRADDLPAYLDNGMVTTPAMRELTFTFRERLVLIPVELVLALKP
TAAVCAVIFLLAALLGGVPAGLWTLLAYAGAVFTGIAVAPLLLPWLPVRSFAVKGALAGL
AWSTGYYLLAGGGSWSVPVAIAAFLTLPAVSAFYTLNFTGCTTFTSRSGVKKEMRLALPV
MGGALAVSALLLVAGLFL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtcggagcttgcctggacagaccggctcggcggatggaaggcgcgttgggggatc
ggccgcatgagctacctgattcccgccggtctctacgccgtaggccagccgaccccggcc
gatcccgttgtggtgacggccaattacaagatgagctacgatctggtgcggcgctcactg
gccggccgcaacgtctggctgctggtgctggagactttcggcattaacgtctggtgtgcg
gcggggaagggaaccttcggcacggacgagctggtacggcgcatcggcgcgaccggactg
gcgcaggtggtaacccatcggcgcctgctcctgccgattctgggtgcgcccggcgtggct
gcccacgaggtggccgggctgaccggttttacggtcagatacgcgacgatccgggccgac
gacctgccggcctatctggacaacggcatggtgacgactccggcgatgcgggaactgacc
tttacctttcgggagcggctcgtgcttatcccggtggaactggtgctggcactgaagccg
acggccgctgtctgtgcggtaatcttcctgttggcagccctgctcgggggtgttcctgcc
gggctctggacccttttggcctatgccggcgcggtctttaccggcatagcggttgcgccg
cttctccttccatggcttccggtgcgaagctttgccgtcaagggcgcgctggcaggtctt
gcctggagcacgggctactatctgctcgctggcggcggcagctggagtgtgccggtggcg
attgcagcatttctgaccctgccggcggtgagcgccttctacaccctcaatttcacgggg
tgcaccacgtttacctcccgttccggcgtgaagaaggaaatgcggctcgccctgccggtc
atggggggcgcccttgccgtcagtgcactgttgctggtggcggggttgtttctgtag

DBGET integrated database retrieval system