KEGG   Geobacter uraniireducens: Gura_1072Help
Entry
Gura_1072         CDS       T00521                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
gur  Geobacter uraniireducens
Pathway
gur03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gur00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Gura_1072
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gur03011]
    Gura_1072
Ribosome [BR:gur03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Gura_1072
  Bacteria
    Gura_1072
  Archaea
    Gura_1072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABQ25278
UniProt: A5GAX0
Position
1276123..1276458
Genome map
AA seq 111 aa AA seqDB search
MESSAKLSFARLSPRKTRLVVDMVRGKGIQNALNTLRFSPQPSAKLVSKLLSSAVANAEQ
KGVADVDRLYVKTIYVNGGTVLKRFVPRAMGRASKIRKPTSHICVVLAEKK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaagcgctaagttatcattcgcccgtctgtcccctcgcaaaacacgcctagta
gtggatatggttaggggtaaagggatacagaacgctctcaatacattgcgtttttcgcca
caaccatcggctaagctggtatccaaattgctgtcatctgctgtagcaaatgcagagcaa
aagggcgttgctgacgttgatcgtctttatgtaaaaactatttatgtaaacggtggtact
gttttgaagcgttttgttccgcgggcgatgggaagagcgagcaagattagaaaaccgacc
agtcacatttgtgtggtactggcggagaagaaataa

DBGET integrated database retrieval system