KEGG   Geobacter uraniireducens: Gura_1172Help
Entry
Gura_1172         CDS       T00521                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gur  Geobacter uraniireducens
Pathway
gur00040  Pentose and glucuronate interconversions
gur00052  Galactose metabolism
gur00500  Starch and sucrose metabolism
gur00520  Amino sugar and nucleotide sugar metabolism
gur01100  Metabolic pathways
gur01130  Biosynthesis of antibiotics
Module
gur_M00362  Nucleotide sugar biosynthesis, prokaryotes
gur_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Gura_1172
   00052 Galactose metabolism
    Gura_1172
   00500 Starch and sucrose metabolism
    Gura_1172
   00520 Amino sugar and nucleotide sugar metabolism
    Gura_1172
Enzymes [BR:gur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Gura_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: ABQ25376
UniProt: A5GAM8
Position
1382577..1383458
Genome map
AA seq 293 aa AA seqDB search
MQVKKAIFPVAGLGTRFLPATKSTPKEMLPLIDKPLVQYVVEEAVASGIEQILFVTGRSK
RAIEDHFDISFELESLLYDKGKDAELSQIREIADMINIFYVRQKQALGLGHAILCAKEFV
GNEPFAVLLGDDIIDAEKPCLGQLLEVYRKYRGPVLALEQVPMENISSYGCVKANTISER
VFEVVDMVEKPKREEAPSDLAIIGRYILTPDIFPILERQEPGKGGEIQLTDAIKKLANDE
AIYGCRFEGIRHDCGDKLGFLKATVDMALKREEFNGEFEAFLRQRLGVCRTQE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtaaaaaaagcgatattccccgttgccggacttggtacacggtttcttcccgcc
accaaatctactcccaaagagatgcttcccctcatcgacaagcccctggtgcagtacgtt
gttgaagaggcggtggcttccggcatcgagcagattctgttcgtgaccggccgaagcaag
cgggccattgaagatcatttcgacatttccttcgagcttgaatcgctcctctacgataag
gggaaggatgcggaactttcccagatccgtgaaattgccgatatgatcaatatcttctac
gtgcggcagaaacaggctctcggcctcggtcacgccattctctgcgccaaggagtttgtc
ggcaacgagccgtttgccgtcctgctcggcgatgacatcatcgacgcggagaaaccttgc
ctcggccagctgctggaggtttaccggaagtatcgcgggccggtcctcgccctggagcag
gttcccatggagaacatctcttcctatggctgcgtcaaggccaataccatctccgagcgg
gtttttgaagtggtggacatggtggaaaaaccgaagagggaagaggcaccgtcggacctg
gccatcatcggccgttacatcctcacccccgatattttcccgatcctggagcgacaggag
ccggggaaggggggggaaatccagcttaccgacgccattaaaaaactggcaaatgatgag
gccatctacggctgccgctttgaaggcatccgtcacgactgcggcgacaagctgggcttt
ctcaaggccacggtggatatggctctgaagcgggaagagttcaacggcgagttcgaagcg
ttcctgcggcaaaggctaggagtctgtcggactcaggagtga

DBGET integrated database retrieval system