KEGG   Geobacter uraniireducens: Gura_1735Help
Entry
Gura_1735         CDS       T00521                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gur  Geobacter uraniireducens
Pathway
gur00260  Glycine, serine and threonine metabolism
gur00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gur01100  Metabolic pathways
gur01110  Biosynthesis of secondary metabolites
gur01130  Biosynthesis of antibiotics
gur01230  Biosynthesis of amino acids
Module
gur_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gura_1735
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Gura_1735
Enzymes [BR:gur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Gura_1735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABQ25929
UniProt: A5GES4
Position
2017053..2018405
Genome map
AA seq 450 aa AA seqDB search
MNTKIMLNEDQIPKQWYNIIPDMPGPLAPVINPRTLKPVTPEDMLAIFPLSIIEQEMSPQ
RWIDIPDEVREIYKLWRPSPLYRAHRLEQALGTPAKIYYKYEGVSPAGSHKPNSAIPQAW
YNKQAGIRRLATETGAGQWGSSLALACSMFGLECTVYMVKVSCSQKPYRKSMMQLWGANV
IPSPSEFTNAGRAILAHDPDNMGSLGIAISEAVEDAASHADTNYALGSVLNHVCLHQTVI
GQEAKEQMKIAGDYPDVVIACCGGGSNFAGLTFPFIADRAAGKKVRCLAVEPASCPTLTK
GIYAFDYGDTAKMAPISMMYTLGHDFMPPGIHAGGLRYHGDSPLVSQLYHAGEIEAKSYK
QNACFEGAVLFARSEGIVPAPESSHALRAAIDEAVLAKEEGKEKTILFGLSGHGQLDMGA
YDAYLSGALEDYEYPEEKIREALERLPKVG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaagatcatgctcaatgaagatcagatcccgaaacagtggtacaacatcatt
cccgacatgccggggccgctggcgccggtgataaatccccggaccctcaagccggtgacg
cctgaagatatgctcgccatctttcccctgtcgatcatcgagcaggaaatgtccccccag
cgctggatcgacatccccgacgaagttcgcgagatttacaagctctggcgtccctcgccg
ctctaccgggcacacaggttggagcaggctctcggtacgccggcaaagatctattacaaa
tacgaaggggtgtcgccggccggttcccataaacccaactccgccataccccaggcctgg
tacaacaagcaggccggtatccgccgcctcgctaccgaaaccggggccgggcagtggggg
agctccctggccctggcatgcagcatgttcggcctggagtgcacggtttacatggtcaag
gtgtcatgctcccagaagccgtaccgcaagagcatgatgcagctctggggggcgaacgtc
attccctccccgtccgagttcaccaatgccgggcgcgccatcctggcccacgacccggac
aacatggggagcctcggcattgccatctcggaggcggtggaagacgcggccagccacgcc
gacaccaactatgcgctcggcagcgtcctcaaccacgtatgtctccaccagaccgttatc
ggccaggaggcgaaggagcagatgaagattgccggcgattacccggacgtggtcattgcc
tgctgcggcggcggctcgaacttcgccgggctcaccttccccttcattgccgaccgggcc
gcggggaagaaggtgcgctgtctcgccgtggagcctgcttcctgcccgaccctcaccaag
ggtatctacgccttcgattacggcgacacggccaagatggccccgatatccatgatgtac
accctcgggcacgatttcatgccgccgggaatccatgccggcggccttcgctaccacggc
gattcgccgctggtttcacagctttaccacgccggggagatagaggctaagagctacaag
cagaacgcctgcttcgagggtgcagtgctgttcgcccggagcgaagggatcgtgccggcg
cccgagtcgtcccacgccctcagggctgccatcgacgaggcggtcctggccaaggaggag
gggaaggaaaaaaccatcctcttcggtctttccggccatggccagctggatatgggtgct
tacgacgcctatttgtccggggcgctggaggattacgagtacccggaggaaaaaatcaga
gaggcgctggagaggttgccgaaagtaggttaa

DBGET integrated database retrieval system