KEGG   Geobacter uraniireducens: Gura_1780Help
Entry
Gura_1780         CDS       T00521                                 

Definition
(GenBank) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
gur  Geobacter uraniireducens
Pathway
gur00010  Glycolysis / Gluconeogenesis
gur00680  Methane metabolism
gur01100  Metabolic pathways
gur01110  Biosynthesis of secondary metabolites
gur01120  Microbial metabolism in diverse environments
gur01130  Biosynthesis of antibiotics
gur01200  Carbon metabolism
gur01230  Biosynthesis of amino acids
gur03018  RNA degradation
Module
gur_M00002  Glycolysis, core module involving three-carbon compounds
gur_M00394  RNA degradosome
Brite
KEGG Orthology (KO) [BR:gur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gura_1780
  09102 Energy metabolism
   00680 Methane metabolism
    Gura_1780
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Gura_1780
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gur03019]
    Gura_1780
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gur04147]
    Gura_1780
Enzymes [BR:gur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     Gura_1780
Messenger RNA biogenesis [BR:gur03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Gura_1780
Exosome [BR:gur04147]
 Exosomal proteins
  Proteins found in most exosomes
   Gura_1780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-ProteinID: ABQ25970
UniProt: A5GEW5
Position
complement(2058855..2060144)
Genome map
AA seq 429 aa AA seqDB search
MSQITDVYAREILDSRGNPTLEVEVFLESGAMGRAAVPSGASTGEREALELRDGDKGRYL
GKGVLKAVANVNDIIADEVIGMEATDQVGIDRKMLDLDGTEYKSKLGANAILGVSLAVAK
AAADEVGLSLYQYIGGSNAKELPLPMMNIINGGAHADNNVDIQEFMIMPAGAKNFAEALR
MGAEIFHALKAVLKAKGYNTAVGDEGGFAPNLKSNEEALQVIMEAITKAGFKPGEDVLLA
LDVASSELFKDGVYTLENEAQPQKTADQLIDFYENLVNKYPIISIEDGMAENDWDGWKKM
TERLGKRIQIVGDDLFVTNPRILKEGIDKGIANSILIKLNQIGTLTETLDAIEMAKRAGY
TTVISHRSGETEDTTLADLSVAVNAGQIKTGSLCRTDRVCKYNQLLRIEDELDAVALFRG
KEVFYNLKK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagccagattacagatgtgtacgccagggagatcctcgattcacggggcaatccgaca
ctggaagtggaagtctttctcgaatcgggagccatgggcagagcagcggtcccgtccggc
gcctcaacaggagagcgggaagctctggaactgcgcgacggcgacaagggtcgctatctc
ggcaagggtgttctgaaggctgttgccaacgtcaacgacatcattgccgatgaagtgatc
ggcatggaagcgactgaccaggttgggatcgacaggaagatgctcgatctggacggcacc
gaatataaaagcaaactgggagccaacgccatcctcggcgtttccctggccgtggccaag
gccgctgccgacgaagtagggctttccctttatcagtatatcggcggatcaaacgccaag
gaactgccgttgccgatgatgaacatcatcaacggcggcgcccatgccgacaacaacgtg
gacatccaggaattcatgatcatgccggccggcgccaaaaactttgccgaagcgctccgc
atgggtgcggaaatttttcacgctctcaaggcggttcttaaagccaaaggttacaacacc
gccgtcggcgacgaaggtggctttgcaccgaacctgaagtccaacgaagaggcactgcaa
gtaatcatggaagcgatcaccaaggccggcttcaaaccgggcgaggatgtgctgctcgcc
ctggacgtggcctcctccgagttgttcaaggacggcgtctataccctggaaaacgaggca
cagccgcagaaaaccgccgaccagctcatcgatttctacgagaacctggtcaacaagtac
ccgatcatctccatcgaggacggcatggcagaaaacgactgggacggctggaagaaaatg
accgagcgcctcggcaaaagaatccagatcgtcggcgacgacctgttcgtcaccaacccc
aggatactcaaggaagggatcgacaagggaattgccaactccatcctgatcaagctcaac
cagatcggtaccctaaccgagaccctcgatgccattgaaatggccaagcgggccggctac
accacggtcatctcgcaccgctccggcgaaaccgaggacaccaccctggccgacctttcc
gtggcagtcaacgccggccagatcaagaccggctcgctctgccgcaccgatcgggtctgc
aagtacaaccagttgctgcgcatcgaggacgagctggacgccgtggcgctgttcagaggg
aaagaggttttttacaacctgaagaaatag

DBGET integrated database retrieval system