KEGG   Geobacter uraniireducens: Gura_1870Help
Entry
Gura_1870         CDS       T00521                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
gur  Geobacter uraniireducens
Pathway
gur00260  Glycine, serine and threonine metabolism
gur01100  Metabolic pathways
gur01110  Biosynthesis of secondary metabolites
gur01120  Microbial metabolism in diverse environments
gur01130  Biosynthesis of antibiotics
gur01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gura_1870
Enzymes [BR:gur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Gura_1870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 DUF3971
Motif
Other DBs
NCBI-ProteinID: ABQ26060
UniProt: A5GF55
Position
complement(2170404..2171471)
Genome map
AA seq 355 aa AA seqDB search
MKRADLQKPLQHHQFASDNYAGICPEAMQAMAEANRGYASSYGDDYWTGKACERLRELFE
TDCEVFFVFNGTAANSLALASLCQSYHSIICHEMAHIETDECGASEFFSNGTKVLLVHGE
NGKVDLGEIEHTVQRRTDIHYPKPRALSITQATELGTVYTVDEMQAIGEVARRFSLRIHM
DGARFANAIASLNVAPKEITWKAGVDVLCFGGTKNGFAMGEAVIFFNRELAFEFDYRCKQ
AGQLASKMRYLAAPWIGTLESGAWLRHAAHANACARKLEKELQSIAGIRVMFPCQANSVF
LEMPPTLMEALRNRGWHFYTFIGSGGARFMCSWETSDADIAALVKDIRELVQQNT
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtgccgatcttcaaaaaccgctgcagcatcatcagtttgccagcgacaattac
gccgggatctgcccggaagcaatgcaggcgatggcggaagcaaatcgcggctacgcctca
tcgtacggagacgactactggaccggcaaggcctgcgaacggctgcgggagctctttgag
accgactgcgaggtgtttttcgtctttaacggcacggcagccaactctctggcgcttgct
tcgctctgccagtcctatcacagcatcatctgccacgaaatggcgcacatcgaaaccgac
gagtgcggcgcttccgagtttttctccaacggcaccaaggttttgctggtgcatggtgaa
aacggaaaggtcgatctcggagaaattgaacatacggttcagcgccgcacggacatccac
tatccgaaaccgcgtgcgctgagtataacccaggcaacggaactgggcacggtctacacc
gttgatgaaatgcaggcgatcggcgaggttgccaggcgtttttctctgcggattcatatg
gacggagcccgtttcgccaatgccatagcgtccttgaacgtcgcaccgaaggaaatcaca
tggaaagcgggggtggatgtgctctgtttcggcggaacgaaaaacggcttcgccatgggc
gaagccgtcattttctttaaccgcgaactggcattcgagttcgactaccgttgcaaacag
gctgggcaactcgcctcaaagatgcgctaccttgccgctccatggatcggcaccctggaa
agcggcgcctggctgcgtcatgctgcccatgccaatgcctgcgcccggaagctggaaaaa
gagctgcaatccattgccggcatcagagtcatgttcccctgccaggcaaactccgtattt
ctggagatgccgccaacgctgatggaagcgctgcgcaaccgcggctggcacttttacacc
ttcatcggctctggaggcgcccgcttcatgtgctcatgggaaaccagcgatgcggacatc
gccgctctggtgaaggacatccgcgaactggtgcaacagaatacctag

DBGET integrated database retrieval system