KEGG   Geobacter uraniireducens: Gura_2196Help
Entry
Gura_2196         CDS       T00521                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
gur  Geobacter uraniireducens
Pathway
gur00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:gur00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Gura_2196
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gur01007]
    Gura_2196
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gur03016]
    Gura_2196
   03029 Mitochondrial biogenesis [BR:gur03029]
    Gura_2196
Enzymes [BR:gur01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Gura_2196
Amino acid related enzymes [BR:gur01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Gura_2196
Transfer RNA biogenesis [BR:gur03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Gura_2196
 Prokaryotic Type
   Other AARSs
    Gura_2196
Mitochondrial biogenesis [BR:gur03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Gura_2196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d
Motif
Other DBs
NCBI-ProteinID: ABQ26383
UniProt: A5G3L5
Position
complement(2555132..2556913)
Genome map
AA seq 593 aa AA seqDB search
MIDFLGGWKRTHYCGALTAGDIGKEVVLMGWAHRRRDHGGLIFVDLRDREGLAQVVFDPD
NSPAAHKKAEAIRNEYVVAIRGKVIPRPDGTVNANLKTGEVEVLVSECKMLNRSKALPFT
LDDYVDVAENLRLKHRYLDLRRPVLQENLILRSKVAQITRQYLTGNGFLELETPFLTKST
PEGARDFLVPSRINRGEFYALPQSPQLFKQILMVSGFDRYFQVVRCFRDEDLRADRQPEF
TQIDCEMSFIDREDIITVMEGLIARIFTETKGATVNLPIPRMTYAESIRRFGVDNPDLRF
GLELVELSDIVKNAGFKVFADVVAGGGIVKGLNAKGCGGMSRKEIDDLTEFAKIYGAKGL
AYVKMTAEGWQSPIAKFFTAEEISAMDKAFDAKEGDLLLFVADKPKVVNDSLGKLRNHLA
KSLGLLDKDTFNFVWITDFPLLEWDEEEKRWAAVHHPFTAPMDEDLEYVESDPGRCRAKA
YDLVLNGNEIGGGSIRIHQEKIQSLMFKMLGHSEEDARTKFGFLLDAMDYGAPPHGGIAF
GLDRLIMLLTGSDSIRDVIAFPKTQKGACLMSEAPSAVDMKQLRELGLKTVVK
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgatagattttctcggaggctggaagagaacccattattgcggagctttgaccgcgggt
gatatagggaaagaagtggtgctgatgggatgggcgcaccgtcggcgcgatcatggcggg
ttgatattcgttgacctgcgcgatcgggagggtttggcccaggtggttttcgacccggat
aacagtccggcggcacacaaaaaagctgaagcgatccgcaatgaatatgtggtggcaata
cggggcaaggtaataccccgccctgatggcacggtcaatgcgaacctcaagaccggcgaa
gtggaagtgctggtatcggaatgcaagatgctcaatcgctccaaggcgcttccctttacc
ctggatgattatgtggatgtggctgaaaacctgcgcctcaagcaccgttatctggattta
cgtcgtccggttctccaggaaaaccttatcctccgctcgaaggttgcccagattacccgt
cagtatctgaccggtaatggtttcctggagctggaaacgccgttcctcacgaaatcgacg
cctgaaggtgcccgcgattttctcgtcccgtctcggatcaaccggggtgagttttatgcc
ttgccgcaatctccgcagcttttcaagcaaattctgatggtatcgggttttgaccgctac
tttcaggtagtccgctgtttccgcgatgaggacctgcgcgccgaccggcagccggaattt
acccagatcgattgcgagatgtcgttcattgatcgtgaggacatcataaccgtcatggag
gggcttattgcccggatatttaccgagacaaagggggcgacggtaaatctccccatcccg
cgcatgacctatgccgagtcaatccgccgctttggcgttgataatcccgatcttcgtttc
gggctggaactggtcgagttgtctgatatcgtcaaaaacgccggattcaaggtgtttgcc
gatgtggtggccggcggcgggatcgtcaaggggctgaatgccaaggggtgtggcggcatg
tcgcgcaaggagatcgacgacctgaccgagttcgccaagatttacggtgcaaagggtttg
gcttacgtgaagatgaccgccgaggggtggcagtcacccatcgccaaattctttaccgct
gaggaaatctcggccatggacaaggcatttgacgccaaagaaggcgatctgcttctcttt
gtcgccgacaaaccgaaggtcgtcaacgattcgctgggtaagctgcgcaatcacctggcc
aaaagtctcgggctgctggataaggatacctttaattttgtctggatcaccgacttccct
cttttggagtgggacgaagaagaaaaacggtgggctgccgtacatcacccattcaccgct
ccgatggatgaggatctggaatatgttgaatccgatccgggccgctgtcgcgccaaggct
tatgatctggtgctgaacggcaacgaaatcggcggaggcagcatcaggatacatcaggaa
aaaattcagtctcttatgttcaagatgcttggccactccgaggaagacgcacggaccaaa
ttcggttttctgctggatgccatggattacggagctccgccccacggtggaatcgccttt
ggtcttgaccgcctcatcatgcttctcaccggcagtgattcgatcagggatgtcatcgct
ttccccaaaacccagaaaggcgcctgtctgatgtctgaggcgccgtctgctgtagatatg
aagcaattgcgagaactcgggctgaaaacggtcgtcaaataa

DBGET integrated database retrieval system