KEGG   Geobacter uraniireducens: Gura_3998Help
Entry
Gura_3998         CDS       T00521                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gur  Geobacter uraniireducens
Pathway
gur00020  Citrate cycle (TCA cycle)
gur00640  Propanoate metabolism
gur00660  C5-Branched dibasic acid metabolism
gur01100  Metabolic pathways
gur01110  Biosynthesis of secondary metabolites
gur01120  Microbial metabolism in diverse environments
gur01130  Biosynthesis of antibiotics
gur01200  Carbon metabolism
Module
gur_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gur_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gura_3998
   00640 Propanoate metabolism
    Gura_3998
   00660 C5-Branched dibasic acid metabolism
    Gura_3998
Enzymes [BR:gur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Gura_3998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ABQ28142
UniProt: A5G8M4
Position
4650861..4652024
Genome map
AA seq 387 aa AA seqDB search
MNIHEYQAKEILSSFGIPVPRGRVALTSDQVERAAKEMGGRCVVKAQIYAGGRGKAGGVK
LVHHPEQAQELGKDLFTRKLVTPQTGPEGLRVRRILVEEAVEIAREFYLSITLDRESSRY
CLIASAEGGVEIEEVAQKSPEKIHMLTIDPFTGLRPYQARKIALALGLAGSVCEDCVELI
LNLYRLCLEKDCYLVEINPLVVTRAGWLMAMDAKINFDDNAMFRHREYPDMLDYSQLDTL
EINAGKYDLSYIKLQGNIGCMVNGAGLAMATLDVLKEFGGEPANFLDVGGGATREKVAEA
FKIILQDSDVKGVFVNIFGGIMRCDVIAQGIIEAASEVHCALPIVVRMDGSKVEEGKKLL
LDSGLNVQIGENLGDGAARIVQMLGQK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgagtaccaggccaaagagattttaagctccttcggcattccggtgcca
cgcggcagggttgctctgacctccgaccaggtggaacgtgcggccaaggagatgggaggg
cgttgcgtggtgaaggcccagatatacgccggcggcaggggtaaggccggcggcgtcaag
ctggtccaccacccggagcaggcgcaggaactggggaaggacctgttcaccaggaaactg
gtcacaccgcagaccggcccggagggtctaagggtgcggaggattctggtagaggaggcg
gtggaaatcgctcgcgagttctatctctccatcaccctcgaccgggaatcatcccgctac
tgcctgatcgcctcggccgaaggcggggtagagatcgaagaggtggcgcaaaagtcgccg
gagaagatccacatgcttaccatcgacccgttcaccggacttcgtccctaccaggcgcgc
aaaatcgcccttgccctcggcctggcggggagcgtctgcgaggactgcgtcgagctgatc
ctgaacctgtaccgtctctgcctggaaaaggactgctacctggtggagatcaacccgctg
gtagtgaccagggcggggtggctcatggccatggacgccaagatcaactttgacgacaac
gccatgttccgccaccgggagtaccccgacatgctcgactactcccagctcgacacactg
gagatcaacgccggcaagtacgacctctcctacatcaagctgcagggaaatatcggctgt
atggtgaacggcgccggtctggccatggcaaccctggacgtgctcaaagagttcgggggc
gaacccgccaacttcctcgacgtggggggtggagcaaccagggaaaaggtggccgaggcg
ttcaagattatcctccaggactctgacgtcaaaggggtctttgtcaatattttcggcggc
atcatgcgttgcgacgtaatcgcccaggggatcatcgaggcggcctccgaggtgcactgt
gcactccccatcgtggtgagaatggacggcagcaaggtggaagagggaaaaaagctcctt
ctggattcgggcctgaacgtccagatcggtgaaaacctgggggacggcgctgcgcggatt
gtccagatgcttggccagaaataa

DBGET integrated database retrieval system