KEGG   Gardnerella vaginalis 409-05: HMPREF0424_0272
Entry
HMPREF0424_0272   CDS       T01146                                 
Name
(GenBank) adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
gva  Gardnerella vaginalis 409-05
Pathway
gva00230  Purine metabolism
gva00730  Thiamine metabolism
gva01100  Metabolic pathways
gva01110  Biosynthesis of secondary metabolites
gva01232  Nucleotide metabolism
gva01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:gva00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HMPREF0424_0272
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    HMPREF0424_0272
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gva04147]
    HMPREF0424_0272
Enzymes [BR:gva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     HMPREF0424_0272
Exosome [BR:gva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF0424_0272
SSDB
Motif
Pfam: ADK AAA_17 AAA_18 AAA_33 dNK Thymidylate_kin AAA_28 Cytidylate_kin SRP54
Other DBs
NCBI-ProteinID: ADB13935
UniProt: D2R9P4
Position
294630..295190
AA seq 186 aa
MRLLIMGPQGVGKGTQAALLSEHYGIPAISTGDIFRYNLKNHTELGKQVQGYLDKGELVP
DELTNSIVKDRLAQDDAKSGWILDGYPRNASQVQALDRMLEELGTPLDHVVALEAERDVL
LERMQKRAVEQGRSDDTPEVIAKRLETYEKETAPLLDIYDSRGQLVEVDGVGDIKEINNR
IVESLN
NT seq 561 nt   +upstreamnt  +downstreamnt
atgcgattactaattatgggtccacagggcgttggaaaaggcactcaggccgctttgtta
agtgagcattatggcattccagcgatttctactggtgatattttccgctataaccttaag
aatcatactgagcttggaaaacaggttcagggatatcttgacaagggcgagttggttcca
gatgagctgactaacagcattgttaaggatcgtcttgctcaggacgatgcaaagagcggc
tggattctcgacggttatcctcgcaacgcttctcaggttcaagctttggatcgtatgttg
gaagagcttggcactcctctcgatcacgttgtggctctcgaggctgagcgcgatgttttg
ctcgaacgcatgcaaaagcgtgcagtggagcaaggtcgttctgacgatactccagaagta
attgctaagcgtttagaaacgtatgagaaggaaacagctccattgcttgatatctatgat
agccgcggtcagttggttgaagtagatggcgttggagatattaaggaaatcaataatcgc
attgttgaatcacttaattaa

DBGET integrated database retrieval system