KEGG   Gardnerella vaginalis 409-05: HMPREF0424_0820Help
Entry
HMPREF0424_0820   CDS       T01146                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
gva  Gardnerella vaginalis 409-05
Pathway
gva00010  Glycolysis / Gluconeogenesis
gva00520  Amino sugar and nucleotide sugar metabolism
gva01100  Metabolic pathways
gva01110  Biosynthesis of secondary metabolites
gva01120  Microbial metabolism in diverse environments
gva01130  Biosynthesis of antibiotics
gva01200  Carbon metabolism
Module
gva_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0424_0820
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0424_0820
Enzymes [BR:gva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     HMPREF0424_0820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADB13511
UniProt: D2RB53
Position
complement(929353..930126)
Genome map
AA seq 257 aa AA seqDB search
MIDTAQAFGVDIGGSGIKAAPVNLEKGEFAEPRYKILTPTVSTPQAVADIVRQQLEHFEV
PADVPVGIAFPAPIKPGKKLDFMANLDQSWIGVDVTEVFSEACGRPVTVVNDADAAGLAE
QRFGAAKDKDGLVIATTLGTGIGTALIYNGVLIPNTELGHIQLEKGKGDAEKYAASSVRE
KLDMGYKKWAKRLTKYYGLMEKYFNPDLFVVGGGVSRVSEKFLPHIDIKTPIVVATLHNE
AGIIGAAYYAMQKMQQN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgattgacactgcacaagcatttggcgtcgatattggtggatccggtattaaggctgct
ccagtaaatttggaaaagggagagttcgcagaacctcgatacaaaattctcactcctacg
gtttctacgcctcaagcagttgcagatattgttcgtcagcagcttgaacattttgaagta
cctgcagatgttcctgttggaattgcattccctgctccaattaagcctggtaagaagctc
gattttatggcaaatcttgaccagtcttggattggtgttgatgttactgaagtctttagc
gaggcttgtggtcgtcctgtaacagtagttaacgatgccgatgctgctggtttagctgag
cagcgttttggtgcggcgaaagacaaggatggcttggttattgctactactcttggcact
ggtatcggcacggctttgatttacaacggtgtgcttattccaaacactgagcttggtcat
attcagcttgaaaaaggtaagggcgatgctgaaaagtacgctgcttcttctgttcgtgaa
aagttggatatgggctataagaagtgggctaagcgtttgactaagtactacggcctgatg
gaaaagtatttcaacccagatttgtttgttgtcggtggcggtgttagccgcgtaagcgaa
aagttcttgccgcatatcgatattaaaactcctattgttgttgcaacattgcataatgag
gctggaattattggtgcagcttactatgcaatgcaaaagatgcagcaaaactaa

DBGET integrated database retrieval system